KEGG   Hippea maritima: Hipma_0824Help
Entry
Hipma_0824        CDS       T01456                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hmr  Hippea maritima
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0824
   00030 Pentose phosphate pathway
    Hipma_0824
   00051 Fructose and mannose metabolism
    Hipma_0824
   00052 Galactose metabolism
    Hipma_0824
   00500 Starch and sucrose metabolism
    Hipma_0824
   00520 Amino sugar and nucleotide sugar metabolism
    Hipma_0824
  Nucleotide metabolism
   00230 Purine metabolism
    Hipma_0824
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hipma_0824
Enzymes [BR:hmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hipma_0824
    5.4.2.8  phosphomannomutase
     Hipma_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815826..817220
Genome map
AA seq 464 aa AA seqDB search
MQRDVFREYDIRGIWERDIDKEFCFLLGRAFGIYLKENLKKPSGIISIGYDARLSSKDIL
KSLSDGLSCENIDIINIGLVPTPVQYFSLFNLDIDGGIMITASHNPKEYNGFKLSLKKET
LFGAEIQRIADIMEKLGSACDIRAGRVKQADVLSEYKKFMLDQFGYLKDYNSKPKIALDG
GNGTAGFVGYDIFKELGYEVEGLFIEPDGNFPNHHPDPTVEKNLTDLRRVIKEKNIDVGI
GYDGDGDRIGVVLKDGSILWGDQLLLLFAQHIAKKRTDVKVVADVKCSDVIFQKMKECGA
KPIMYKTGHSLIKSKMKQEGAILAGEMSGHIFIGDRYFGYDDAIYVSLRLVEILTTEGID
LVQWKESLPKVYNTPEIRIDCPDEKKTQVITKIKSYLNRNKDKIGILEINTIDGVRFKTD
YGWGLVRASNTQPALVMRFEASSEEKLKELKDKIINTVKGFINE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagatgtttttagagaatatgatataaggggtatctgggaaagggatatagat
aaagaattctgcttccttcttggtagagcttttggtatttatctgaaggaaaacttgaaa
aaaccaagcggcattataagcataggttacgatgctaggttgtcttcaaaggatatactt
aaatctttaagtgatgggttgagttgtgaaaatatagatattatcaatataggtcttgtg
ccaactcccgttcaatatttttctttgtttaatttggatattgatggcggtattatgata
acagcatcccacaaccctaaagaatacaacggttttaaactgtcattgaaaaaagagacg
ttgtttggggctgagattcaaagaatagctgacataatggagaagttgggttctgcctgt
gatataagggcaggcagggtaaagcaggctgatgtactttcggagtataagaaatttatg
cttgatcaatttggatatttgaaggattacaatagcaaaccaaagatagccctggatggt
ggaaatggaacagccggatttgtgggctatgatatatttaaagagttgggatatgaggtt
gaagggttgtttatcgaaccggatggcaactttcccaaccaccacccagacccaaccgtt
gagaagaatttaaccgacttgcgcagggttataaaagagaaaaatatagatgtgggcata
ggttatgatggcgatggagataggattggagttgttttgaaggatggttcgattttatgg
ggtgatcagttattgcttttgtttgcccagcatatagcaaaaaagaggacagatgttaag
gttgtggctgatgttaagtgttccgatgtgatttttcaaaagatgaaggagtgtggtgca
aaacctattatgtataaaacaggtcattccttaataaagtcaaaaatgaaacaggaaggt
gcaatcttagctggtgagatgagcggccatatattcataggtgataggtattttgggtat
gatgatgcaatttatgtgtccttaaggcttgttgagatcttaaccacagaaggtattgat
ttagttcagtggaaagagagtcttcccaaagtttataacacacctgagataaggattgac
tgccccgatgagaaaaaaacacaagttatcactaaaataaaatcgtatttgaacagaaat
aaagataaaattggaattttagagataaacacgatagatggggttaggttcaaaaccgat
tacggctgggggttggttagagccagcaatacccaaccagcgttggtgatgaggtttgaa
gcaagttctgaggagaagctgaaagagttaaaggataaaatcattaacactgttaagggg
tttataaatgagtaa

DBGET integrated database retrieval system