KEGG   Hippea maritima: Hipma_0946Help
Entry
Hipma_0946        CDS       T01456                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hmr  Hippea maritima
Brite
Enzymes [BR:hmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Hipma_0946
Secretion system [BR:hmr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Hipma_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932489..933301
Genome map
AA seq 270 aa AA seqDB search
MKNFKKLILGTSILLIGSNYALAATKYDDVLKKIIPSKINYTAQVEKKSILNGFDQVNVG
IENKKTGTIYHRYLWISKDKKTIIPVVLKLQNGQLRRATPDKLMERVQTNIKWFNDLIGS
LPRNILKSYGNGKTTVYLFSDPLCPFCKRELSNLVKLAKEGKIKLFILPFNVHGEEAKKA
SAIFLDIEEKEGLKAAIDKIENASFSNVKKMVKQTKNVDKLLKKYSSVMDKITQSAFKNG
IQGTPGIVIPKSKEKGYVIVGLSNIDQYIK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttaaaaaactcatcctgggaacatcaatattattaatcggctcaaactat
gcacttgcggcaacaaaatatgatgatgttttaaagaaaatcatcccatcaaaaataaac
tacactgcacaagtcgagaaaaagagtattctaaatggatttgatcaagtaaatgtaggc
attgaaaacaaaaaaactggaacaatctatcaccgctatctttggatatcaaaggataaa
aaaactattataccggttgtccttaaactacagaatggccaactaagaagggcaacacct
gataagctgatggaaagggtgcaaaccaatataaaatggtttaacgaccttataggctca
cttccgaggaatattcttaaatcttacggcaacggcaaaacgacggtttacctatttagt
gacccgctatgtccattctgcaaaagagagttgagtaatttggtaaaattagccaaggaa
gggaaaataaagctttttatactgccatttaatgtacacggagaagaagctaaaaaggca
agtgccatatttttggatattgaagaaaaagaaggactaaaagcagctatagataaaata
gaaaatgcaagtttttccaatgtaaagaaaatggttaaacaaacaaagaacgtggataaa
ctcctaaagaaatactcatccgtaatggataaaataactcaatcagcattcaaaaacggc
attcagggtacgcccggcattgtcataccaaaatccaaagagaaaggttatgtaatagta
gggctttcaaatatagaccaatacattaaatga

DBGET integrated database retrieval system