KEGG   Hippea maritima: Hipma_0955Help
Entry
Hipma_0955        CDS       T01456                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00052  Galactose metabolism
hmr00500  Starch and sucrose metabolism
hmr00520  Amino sugar and nucleotide sugar metabolism
hmr00521  Streptomycin biosynthesis
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Module
hmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_0955
   00052 Galactose metabolism
    Hipma_0955
   00500 Starch and sucrose metabolism
    Hipma_0955
   00520 Amino sugar and nucleotide sugar metabolism
    Hipma_0955
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hipma_0955
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hipma_0955
Enzymes [BR:hmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hipma_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEA33924
UniProt: F2LVZ0
Position
complement(946165..947013)
Genome map
AA seq 282 aa AA seqDB search
MKNYLAVDIGGSYIRYIAVIEEDEFRGKAITKNIDIVSFLSVLIERYGIEKMVVSLAGQV
FDGFIIASPNVDITNSFDFSGYFRSKYNIEVMLENDLNCAAVAEAGYFDAENIAVVYSGS
GIGAGVVDNGKIIRGFRNLALELGHIPYKKAPFRCGCGKNNCLELFASSSGIKKWLKLKG
ADEGFTLNEISLDPELKWIADQYKEALVFGVSVVITLFNPEVVVLGGGIIKSNEWLLNYV
KQKLPEFALNVSLEGVNIEISQLEDGSLEGARILAEGRFDES
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattacttggccgttgatataggcggtagctatatccgatatattgcagttatt
gaagaggatgagtttagaggcaaggcaattacaaaaaatatagatatagttagttttttg
tcggtattgatagaaagatatggcatagaaaagatggtcgtatcgcttgcaggacaggtt
tttgatggttttatcattgcatcacccaatgtagatataacaaacagttttgattttagc
ggttattttcgctccaaatacaacatagaggttatgcttgagaatgatttaaattgtgct
gccgttgccgaggcgggttattttgatgcagaaaatattgccgttgtttattctggtagc
ggtataggagcaggtgttgttgataatggtaagatcataaggggttttagaaacttggct
ttggagcttgggcatataccatacaagaaagccccgtttagatgcggatgtggcaagaat
aactgtttagagctttttgcatcatcaagcggcataaaaaaatggttaaaactcaaaggt
gccgatgagggctttacacttaatgagatatccttagaccctgagctgaaatggatagca
gatcaatacaaagaagctttagtttttggtgtttctgttgttataacgctattcaatcca
gaggttgttgttcttggtgggggaattataaaatctaatgaatggcttttgaattatgtg
aaacaaaagctgccagagtttgcactcaatgttagtcttgaaggtgttaatatagagata
tcccagcttgaggatggttcacttgagggtgcaagaatcttagctgaaggtagattcgat
gagtcttaa

DBGET integrated database retrieval system