KEGG   Hippea maritima: Hipma_1046Help
Entry
Hipma_1046        CDS       T01456                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
hmr  Hippea maritima
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1034830..1035780)
Genome map
AA seq 316 aa AA seqDB search
MSQRRESDKLSAIIKEALYRATKRNMVLTPFNYYKVFTEVALEYGLDESEVHKMLYGMAD
VSASELEDLKKRVLEISTNVKDVTVNMERTLQESEATYDMTVKNIDEYRSKVDNSIASEL
EKIKYINSSLKAELEAARNVLEKQRKAIENIKDLSLKDHLTGLYLRKYMNEVLDSALYNF
NRYSKVFSIIMLDLDDFKKINDTYGHLAGDEVLKVVGSVLKRITRRSDIPIRYGGDEFIV
ILPETKLEDAMIVAKKIKDKIASITFKKDKIEFKCTASIGITQVREGDTVESLLERVDKA
LYQTKNSQKGEISVVE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagaagagaatcggataagctttctgctataataaaagaggctctatatagg
gctacaaaaagaaatatggttttgacgccgtttaactactacaaggtttttacggaagta
gctttagagtatggtcttgatgaatctgaagttcataaaatgctttatggaatggctgat
gtttctgcctcagaacttgaggatttaaagaaaagagtgcttgagatttcaactaacgta
aaagatgttacggtaaatatggagagaacacttcaagagagtgaagctacctatgatatg
actgtaaagaatatagatgagtataggagtaaggttgataatagtatagcttcagagctt
gaaaaaataaaatatataaattcatctttaaaagcagagcttgaggctgcaaggaatgta
cttgaaaaacagagaaaagccatagagaatataaaggatctttctctcaaagatcattta
acaggcctatacttgagaaaatatatgaatgaagttttggattcagcactgtataacttc
aatagatactctaaggtatttagcattataatgttagatttagatgattttaaaaagata
aatgatacatatggccatttggctggagatgaggttttgaaagttgtaggatcagttttg
aaaaggattacacgaagaagcgatatacctattaggtatggcggtgatgaattcatcgtt
atattgcctgaaactaaactcgaagatgccatgatagttgcaaaaaagataaaagataag
atagcatctataacttttaaaaaagataaaatagagtttaagtgtacagcttctataggt
ataacccaggtaagagaaggagatacggtagagtccctgcttgagagggtggataaggca
ttgtatcagacaaaaaacagtcaaaaaggcgaaataagtgttgtggagtga

DBGET integrated database retrieval system