KEGG   Hippea maritima: Hipma_1046Help
Entry
Hipma_1046        CDS       T01456                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
hmr  Hippea maritima
Brite
Enzymes [BR:hmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Hipma_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1034830..1035780)
Genome map
AA seq 316 aa AA seqDB search
MSQRRESDKLSAIIKEALYRATKRNMVLTPFNYYKVFTEVALEYGLDESEVHKMLYGMAD
VSASELEDLKKRVLEISTNVKDVTVNMERTLQESEATYDMTVKNIDEYRSKVDNSIASEL
EKIKYINSSLKAELEAARNVLEKQRKAIENIKDLSLKDHLTGLYLRKYMNEVLDSALYNF
NRYSKVFSIIMLDLDDFKKINDTYGHLAGDEVLKVVGSVLKRITRRSDIPIRYGGDEFIV
ILPETKLEDAMIVAKKIKDKIASITFKKDKIEFKCTASIGITQVREGDTVESLLERVDKA
LYQTKNSQKGEISVVE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagaagagaatcggataagctttctgctataataaaagaggctctatatagg
gctacaaaaagaaatatggttttgacgccgtttaactactacaaggtttttacggaagta
gctttagagtatggtcttgatgaatctgaagttcataaaatgctttatggaatggctgat
gtttctgcctcagaacttgaggatttaaagaaaagagtgcttgagatttcaactaacgta
aaagatgttacggtaaatatggagagaacacttcaagagagtgaagctacctatgatatg
actgtaaagaatatagatgagtataggagtaaggttgataatagtatagcttcagagctt
gaaaaaataaaatatataaattcatctttaaaagcagagcttgaggctgcaaggaatgta
cttgaaaaacagagaaaagccatagagaatataaaggatctttctctcaaagatcattta
acaggcctatacttgagaaaatatatgaatgaagttttggattcagcactgtataacttc
aatagatactctaaggtatttagcattataatgttagatttagatgattttaaaaagata
aatgatacatatggccatttggctggagatgaggttttgaaagttgtaggatcagttttg
aaaaggattacacgaagaagcgatatacctattaggtatggcggtgatgaattcatcgtt
atattgcctgaaactaaactcgaagatgccatgatagttgcaaaaaagataaaagataag
atagcatctataacttttaaaaaagataaaatagagtttaagtgtacagcttctataggt
ataacccaggtaagagaaggagatacggtagagtccctgcttgagagggtggataaggca
ttgtatcagacaaaaaacagtcaaaaaggcgaaataagtgttgtggagtga

DBGET integrated database retrieval system