KEGG   Hippea maritima: Hipma_1051Help
Entry
Hipma_1051        CDS       T01456                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hmr  Hippea maritima
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hipma_1051
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_1051
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hipma_1051
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hipma_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1039681..1041048)
Genome map
AA seq 455 aa AA seqDB search
MKYKSTRGGVSDLNFTDAFLMGLATDGGLIVPQTIPNVDLDNLRDLDYNNLAFEIFRLFI
DDIPYNDLRTLIGKSYSTFDTQEVTPVVKKNGLFILELFHGPTFAFKDVALQFLGNLFEY
VLKKRNTYVNVLGATSGDTGSAAIYGLKGKENINIFILHPHNKVSKVQELQMTTVEDVNV
YNLAIEGTFDDCQAIVKSIFNDLKFKEKYHLAAVNSINWARILAQIVYYFYAYFKSGVDK
AYFSVPTGNFGDIFAGYMAKRMGLPIEKLILATNSNDILYRFVNYGDYSTGKVVKTLSPS
MDIQVASNFERYLYYLSDENSIRVKELMDEFTRTKKLKFEGDLLKKVQLDFESYRAGVED
TLATIKRFYEETGYIVDPHTAAGVFAAIKAGYRDVICLSTAHPAKFPDAIMDAIGAYPEK
PRAISELEDKNKRMWVLGNSVDEVKKFIEKKLQKG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataagagcactcgaggtggcgttagtgatttgaattttactgatgccttttta
atgggtcttgctacagatggtggtttgatagttcctcagaccattccaaatgttgacttg
gataatctaagagatttagattataacaatcttgcttttgagatatttaggctatttatt
gatgacattccatataatgatttaagaacccttattggtaagagctattcgacgtttgat
acacaagaagtgacacctgttgtaaagaagaatggcctgtttatacttgaattattccat
ggacctacatttgcctttaaagatgtagcactacagtttctgggtaacctatttgagtat
gttttaaagaaaaggaatacctatgttaatgttttgggtgctacaagtggagatacgggt
tctgctgccatatatggattaaagggcaaagaaaatataaacatatttatacttcacccg
cataataaggttagcaaggttcaagagcttcaaatgaccactgttgaagatgtaaatgta
tacaatttagccattgaaggcacttttgacgactgtcaggcgattgttaaaagcatattt
aacgatcttaagtttaaagaaaaatatcatctggctgctgtaaactcgataaattgggct
cgaattttagcccaaatcgtttactatttttatgcctactttaaaagcggcgtagataaa
gcttactttagtgttccgacaggtaattttggtgatatatttgcaggctacatggcaaaa
agaatgggtttgcctatcgaaaagcttattttggccacaaactcaaacgatatactctac
aggtttgttaattacggcgattactcaaccggtaaggtggtaaaaacactttctccgtct
atggatattcaggttgcaagcaactttgagagatatctttattatctgtctgatgaaaat
tcaattagagttaaagagctgatggatgagttcacaaggacaaaaaaacttaaatttgaa
ggtgatttgcttaaaaaggttcaattagattttgagtcatacagggccggtgttgaggat
acactcgcaacgataaaacggttttacgaagagacaggttatattgtggaccctcataca
gcagctggtgtttttgcagccattaaggctggatatcgtgatgttatatgtttatcaacc
gctcaccctgcaaagttcccagatgccattatggatgctataggtgcctatcccgaaaaa
cccagagcaatttctgagcttgaagataaaaataaacgcatgtgggtgcttggtaacagc
gttgatgaggttaagaaatttatagagaaaaaattgcaaaagggttaa

DBGET integrated database retrieval system