KEGG   Hippea maritima: Hipma_1114Help
Entry
Hipma_1114        CDS       T01456                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hmr  Hippea maritima
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hmr00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1102723..1103577)
Genome map
AA seq 284 aa AA seqDB search
MILKSFAKINSLLYVLGKRPDGYHELFTLMHKIDLFDLIEIERNDGGLKFSINIDELNNQ
DNLAVKAARLFFEKTGIKPQVSIEIEKHIPVGGGLGGGSSNAAYTLKGLNELFDFPLSRG
ELFEVAAKIGSDVSFFVEHGDAIAEGRGEIITKVKCNTEGFKVLLAIPNFSVSTAFVYKR
LRLTKLKGLNKMALTVKDGLCSMHELKNHLHNDLESVVLKEFDLLKWIKETLIKEAGNGL
VSGSGSCVFSILGSEVQAEEGLKEQLETRGVLCKTVNFAEEILR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgatactgaaatcgtttgccaagataaattccctgctgtatgtcttgggcaaaaggcca
gacggttatcatgagctttttactttgatgcataaaatagatctgtttgatctgatagag
atagaaagaaatgatggtggccttaagttcagtatcaatatagatgagttaaataatcaa
gacaacttggcggttaaggcagcaaggttgttttttgaaaaaaccggaataaagcctcag
gtgagtatagaaatagaaaaacacatacctgtaggtggtggcttgggcggtggaagttcg
aatgcggcttacacactaaagggcttaaatgaattgtttgattttcccttaagtagggga
gagttatttgaggttgcagcaaagataggaagtgatgtttctttttttgtagaacatgga
gatgcaatagcagagggcaggggcgaaataattacaaaggttaaatgtaatacagaagga
tttaaggtccttcttgcaataccaaattttagtgtttcaacggcatttgtttataaaaga
ttgaggttgacaaagcttaagggcttaaataaaatggctcttactgtgaaggatggtctt
tgctcgatgcatgagcttaaaaaccaccttcacaacgatcttgaaagtgttgttctgaaa
gagtttgatcttttaaaatggattaaagaaaccctaataaaagaagctggtaatggtttg
gtttcaggaagtgggtcttgtgtattttcaattcttggttcggaggtgcaagcggaagag
gggttaaaagagcagcttgaaacgagaggggttttatgtaaaactgtaaactttgcagaa
gaaatcttaaggtag

DBGET integrated database retrieval system