KEGG   Hippea maritima: Hipma_1119Help
Entry
Hipma_1119        CDS       T01456                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hmr  Hippea maritima
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hipma_1119
   00052 Galactose metabolism
    Hipma_1119
   00500 Starch and sucrose metabolism
    Hipma_1119
   00520 Amino sugar and nucleotide sugar metabolism
    Hipma_1119
Enzymes [BR:hmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hipma_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108391..1109257
Genome map
AA seq 288 aa AA seqDB search
MKVKKAVLPVAGFGTRFLPATKSSSKEMLPLVDKPLIHYAVEDAVKAGIEQIIFITGRGK
RAIEDYFDISFELEFHLKLQGKEKLIEKMRQISEMADFVYIRQKEPKGLGHAVLRAKDVV
GNEPFAVILADDVIESKTSGTAQLVDVFNKYHCSVIGLEEVNPDDVSSYGIVAGKEIENG
IFKLDTFVEKPKKEEAPSNTAIIGRYVFTPAIFEELEKTKPGAKGEIQLTDAIESLSKKE
VIYGKVIEGKRFDCGSKLGFLKATIEFALNDKEVNKELTKYIKEVVKC
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaaaaaagctgttctacccgttgctggttttggaacgaggtttcttcctgcc
acaaaatcatcatctaaagagatgctgcctttggttgataaaccccttatccattacgcc
gttgaggatgctgttaaagctggcattgagcagatcatattcatcacaggaaggggcaaa
agggctattgaggattactttgatatatcctttgagcttgagtttcatttaaagcttcaa
ggcaaagaaaaacttatagagaaaatgaggcagatcagcgagatggccgattttgtctat
atcagacagaaagaaccaaagggattgggtcatgccgtcttgagggctaaggatgtggtg
ggcaatgagccgtttgccgtaatcttggcagacgatgtaatagaatcaaaaacaagtggc
acagcccaattggtcgatgtgtttaacaaataccactgttcggttatagggcttgaggag
gtaaatccagacgatgtctcaagttatggtatcgtagcgggcaaggagatagaaaacggc
atatttaaattggacacattcgtggaaaagccaaagaaggaagaggccccaagcaacacg
gctataataggcaggtatgtgtttacgccggctatttttgaagagcttgaaaagacaaaa
cccggggcaaagggcgaaattcaactaacagacgctatagagtccctaagcaaaaaagag
gtgatatacggcaaagtgatagagggcaaaagatttgattgcggaagtaagttgggcttt
ttgaaggcaacaatagaatttgccctaaacgataaagaggtaaataaagaactaacaaaa
tacataaaagaggtggtgaagtgttag

DBGET integrated database retrieval system