KEGG   Hippea maritima: Hipma_1410Help
Entry
Hipma_1410        CDS       T01456                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hmr  Hippea maritima
Pathway
hmr00020  Citrate cycle (TCA cycle)
hmr00640  Propanoate metabolism
hmr00660  C5-Branched dibasic acid metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Module
hmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hipma_1410
   00640 Propanoate metabolism
    Hipma_1410
   00660 C5-Branched dibasic acid metabolism
    Hipma_1410
Enzymes [BR:hmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hipma_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Citrate_bind
Motif
Other DBs
NCBI-ProteinID: AEA34366
UniProt: F2LY43
Position
complement(1393450..1394658)
Genome map
AA seq 402 aa AA seqDB search
MKLHEYQAKEVLAGYGVPVPEGRVTYFPDDAWMVSMELGLPVVLKAQVLTGGRGKAGGVK
IARTSDEVRQIAQELFGKKLVTKQTGPEGVKIRKLLVEKAADIERELYFSIVIDRTTSRP
TVIASKRGGMSIEEVAEKYPEDIIKIPIDPAVGFLPYQIRRLKYDLDLMAQEKEAAKIFS
ALYKVFVEKDCSLLELNPLVVLKSGHMLAVDAKMDIDDNALYRRKEISKMRDLTEVDPDE
LEARFSGLNFIKLTGNIGCMVNGAGLAMTTMDVIKLAGGDPANFLDVGGEATPETIAKGF
EIITRNPSVKAIFINIFGGIVRCDKVANGIIQALKKVEVKIPVVIRLTGMNKEEGMEILK
KSPLKFYIANDLREAAKMVSELANSKAATVEKTTTKEEKKEK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacgagtaccaagccaaagaggttttggcaggatacggcgtacctgtgccg
gagggtagagtaacttatttccctgatgatgcttggatggtctctatggaattgggcctt
cctgtggtgttgaaagctcaggtattaacgggcggaagaggaaaggctggcggcgtaaaa
atagccagaacatcggatgaagttaggcagatagctcaggagttgtttggtaagaagttg
gtaaccaaacagacagggcctgagggtgttaagataaggaaattgcttgttgaaaaggct
gcagacatagaaagggagctttatttttcgatagttattgacagaacaacatccaggccc
acagttattgcctccaaaagaggtggtatgagtattgaggaggtggccgagaagtatcca
gaggatattattaaaatccctattgatccagctgttggatttttgccctatcagataaga
aggcttaaatacgatttggatttgatggctcaggaaaaggaggctgcaaagatatttagt
gccctttataaggtctttgttgagaaggactgctctctacttgagcttaatccgcttgtt
gtgcttaaatctggacatatgttggctgttgatgccaagatggatattgatgataatgct
ctctatagaagaaaagagatatctaagatgagagatctgacagaggtcgatcctgatgag
cttgaagcaagattttcggggttaaactttattaagcttacgggcaacataggatgtatg
gttaatggtgctggacttgcaatgacaacaatggacgttattaagcttgcaggcggcgat
cctgcaaacttcttggatgttggaggtgaggcaactcctgaaacaatagctaaaggtttt
gagataattacaagaaatccaagcgttaaggccatatttattaatattttcggcggtata
gtaagatgcgataaagtggcgaacggtataattcaggcacttaagaaggttgaagttaag
atacctgttgttattagacttacgggtatgaataaagaagagggtatggaaatattgaag
aaaagcccgcttaagttctacatagcaaatgatttaagagaagccgccaaaatggtttct
gagctggcaaatagcaaagctgctactgtagaaaaaacaaccacaaaagaagaaaagaag
gagaagtaa

DBGET integrated database retrieval system