KEGG   Hippea maritima: Hipma_1410Help
Entry
Hipma_1410        CDS       T01456                                 

Definition
succinyl-CoA ligase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hmr  Hippea maritima
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hipma_1410
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hipma_1410
   00640 Propanoate metabolism
    Hipma_1410
   00660 C5-Branched dibasic acid metabolism
    Hipma_1410
Enzymes [BR:hmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hipma_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393450..1394658)
Genome map
AA seq 402 aa AA seqDB search
MKLHEYQAKEVLAGYGVPVPEGRVTYFPDDAWMVSMELGLPVVLKAQVLTGGRGKAGGVK
IARTSDEVRQIAQELFGKKLVTKQTGPEGVKIRKLLVEKAADIERELYFSIVIDRTTSRP
TVIASKRGGMSIEEVAEKYPEDIIKIPIDPAVGFLPYQIRRLKYDLDLMAQEKEAAKIFS
ALYKVFVEKDCSLLELNPLVVLKSGHMLAVDAKMDIDDNALYRRKEISKMRDLTEVDPDE
LEARFSGLNFIKLTGNIGCMVNGAGLAMTTMDVIKLAGGDPANFLDVGGEATPETIAKGF
EIITRNPSVKAIFINIFGGIVRCDKVANGIIQALKKVEVKIPVVIRLTGMNKEEGMEILK
KSPLKFYIANDLREAAKMVSELANSKAATVEKTTTKEEKKEK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacgagtaccaagccaaagaggttttggcaggatacggcgtacctgtgccg
gagggtagagtaacttatttccctgatgatgcttggatggtctctatggaattgggcctt
cctgtggtgttgaaagctcaggtattaacgggcggaagaggaaaggctggcggcgtaaaa
atagccagaacatcggatgaagttaggcagatagctcaggagttgtttggtaagaagttg
gtaaccaaacagacagggcctgagggtgttaagataaggaaattgcttgttgaaaaggct
gcagacatagaaagggagctttatttttcgatagttattgacagaacaacatccaggccc
acagttattgcctccaaaagaggtggtatgagtattgaggaggtggccgagaagtatcca
gaggatattattaaaatccctattgatccagctgttggatttttgccctatcagataaga
aggcttaaatacgatttggatttgatggctcaggaaaaggaggctgcaaagatatttagt
gccctttataaggtctttgttgagaaggactgctctctacttgagcttaatccgcttgtt
gtgcttaaatctggacatatgttggctgttgatgccaagatggatattgatgataatgct
ctctatagaagaaaagagatatctaagatgagagatctgacagaggtcgatcctgatgag
cttgaagcaagattttcggggttaaactttattaagcttacgggcaacataggatgtatg
gttaatggtgctggacttgcaatgacaacaatggacgttattaagcttgcaggcggcgat
cctgcaaacttcttggatgttggaggtgaggcaactcctgaaacaatagctaaaggtttt
gagataattacaagaaatccaagcgttaaggccatatttattaatattttcggcggtata
gtaagatgcgataaagtggcgaacggtataattcaggcacttaagaaggttgaagttaag
atacctgttgttattagacttacgggtatgaataaagaagagggtatggaaatattgaag
aaaagcccgcttaagttctacatagcaaatgatttaagagaagccgccaaaatggtttct
gagctggcaaatagcaaagctgctactgtagaaaaaacaaccacaaaagaagaaaagaag
gagaagtaa

DBGET integrated database retrieval system