KEGG   Hippea maritima: Hipma_1526Help
Entry
Hipma_1526        CDS       T01456                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmr  Hippea maritima
Pathway
hmr00010  Glycolysis / Gluconeogenesis
hmr00620  Pyruvate metabolism
hmr00640  Propanoate metabolism
hmr00680  Methane metabolism
hmr01100  Metabolic pathways
hmr01110  Biosynthesis of secondary metabolites
hmr01120  Microbial metabolism in diverse environments
hmr01130  Biosynthesis of antibiotics
hmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hipma_1526
   00620 Pyruvate metabolism
    Hipma_1526
   00640 Propanoate metabolism
    Hipma_1526
  Energy metabolism
   00680 Methane metabolism
    Hipma_1526
Enzymes [BR:hmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hipma_1526
Lipid biosynthesis proteins [BR:hmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hipma_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C C1q
Motif
Other DBs
NCBI-ProteinID: AEA34482
UniProt: F2LTV6
Position
complement(1501710..1503386)
Genome map
AA seq 558 aa AA seqDB search
MKHNMLNYEEEVKNFKIDVPEYYNFAFDVVDKWAEDRTKLALVWADTPGKNIKKYSFWDI
SVMSNKFANVLLKLGIKKGDNVFVMVPRIVEWYAVMLGLNKVGAVALPAPNILMPEDIRY
RIRKGDVKMAIASASNASKVEAACNNGDCPTLDVKMIIDGDLEGWLSFENQMDMASDKLS
RDDVEPTKSTDPLLIYFTSGTTKYPKMVMHDQAYALAHIVTAKYWHDLKPTDLHWTISDT
GWGKAVWGKLYGQWQIGSAVFMHNAGSHFDAKITLKLLTTQGITSFCAPPTVYRMLIQED
LSQYDFSSLRHCTSAGEPINPEVIKAWKNATGTLIYDGYGQTETVLIVANYPCMPIKYGS
MGKPVPGYDVRIVDDDGNDMPVGEPGHIAVKIKPNHPIGVAKEYYKDEAATAEAFRDDFY
YTGDRAYMDADGYFWFYGRADDVIKSSGYRIGPFEVESALQEHPAVAESAVVGSPDPIRG
TIVKAFIILAKGYEPSDELIKDIQDFVKNKTAPYKYPREIEFVKELPKTISGKIKRAVLR
RMEIEKKLGKKGTNGSFV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaagcataacatgttaaattatgaggaagaggttaagaattttaaaattgatgtgccg
gagtattataattttgcttttgatgttgttgacaagtgggctgaagatagaacaaaactt
gcattggtttgggcagatacgccgggtaaaaatataaagaaatattccttttgggatata
tctgttatgtcaaataaatttgccaatgttttgcttaagctgggcatcaaaaagggcgat
aatgtatttgttatggttccccgtattgttgagtggtatgcggtgatgcttggtttgaat
aaggtgggtgctgttgcactacctgcccccaatatcctgatgcctgaagatatacgctac
aggataaggaaaggtgatgttaagatggcaatagccagcgcatccaatgcatcaaaggtt
gaggctgcctgtaacaatggagattgccctacgcttgatgtcaaaatgattatagacggc
gaccttgaggggtggttgtcttttgagaatcagatggatatggcctctgataaactatca
agggatgatgttgagcctacaaagtctacagacccacttctaatatacttcacaagcggc
acaacgaaatacccaaagatggtaatgcatgatcaggcatatgctttggctcatatcgtt
actgccaaatattggcacgatttgaaacctacagatttgcattggacgatttctgataca
ggttggggtaaggcagtttggggtaaactttacggtcaatggcagataggctctgccgtg
tttatgcataatgccggctcacattttgatgccaagattacacttaagcttttaactacc
caaggtataacctcattctgcgcaccgcccacggtttataggatgttgattcaggaggat
ttgagtcaatatgacttttcatctctgaggcattgcacctcggcaggtgagcctataaac
cctgaggttataaaggcatggaaaaacgcaacgggcacgttgatttatgacggctacggc
cagactgagactgttttaattgttgcaaattatccttgtatgccgataaagtatggctct
atgggcaagcctgttccgggttacgatgtaaggattgttgatgatgacggtaatgatatg
ccggtgggtgagcccggtcatatagctgttaagataaagcccaatcatccaataggtgtt
gcaaaggagtattacaaagatgaagctgctacggctgaagcttttagggacgatttttac
tacaccggcgatagggcttacatggatgcagatggttatttctggttttatggtagagcc
gatgatgtaatcaaatcatcgggatacaggattggcccgtttgaggttgaaagtgcgctt
caggagcatccggctgtggcagaaagtgctgttgttgggagcccagaccctatcagggga
acaattgtgaaggcgtttatcatacttgctaagggttatgaaccctcagatgagctgatt
aaggatattcaggattttgttaagaataaaactgcaccttataagtatccgagagagata
gagtttgtcaaagaactacccaaaaccataagcggcaagattaaaagggcggttttaaga
aggatggagattgagaagaaattaggtaaaaaaggcacaaacggctcgtttgtttag

DBGET integrated database retrieval system