KEGG   Hippea maritima: Hipma_1563Help
Entry
Hipma_1563        CDS       T01456                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hmr  Hippea maritima
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hipma_1563
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_1563
Enzymes [BR:hmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hipma_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1539817..1540551
Genome map
AA seq 244 aa AA seqDB search
MGVLQDILKTKKAEIEKLTPKGKRNKPIFRLNDFFKENQINIIAEIKASSPSAGKIRKID
LDQILKTYSKYAKAISVLTDKTFFGGSFELLRDVADATKLPVLCKDFIIDKKQIDAAYIN
GADLVLLIVRVLDDEKLEELYSYAHKLGLDCLIEVHKEEELDRIKDLKPKIVGVNSRDLD
NLKIDLSRTKKILSQIEFDAIRIAESGIKNKKDIDFLKQYCDGFLIGETLLKTQDINKAF
EELL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttcttcaggacatactaaagacaaagaaggcagagatagaaaagcttacacca
aaaggcaaaaggaacaagcccatttttagactgaatgattttttcaaagaaaaccagatc
aacatcatagcagagataaaagcatcatcaccatcagcgggcaagataagaaaaatagac
ttagaccagatactaaaaacctattcaaaatacgcaaaagcgataagcgttttaacggat
aaaacattctttggggggagctttgagcttttaagggatgtggcagatgccacgaagttg
cctgttctttgtaaggatttcataatagacaaaaaacagatagatgcagcctatataaac
ggggcagaccttgttctgttgatcgtgagggtcttggatgatgaaaaattggaagagcta
tacagttatgctcacaagttaggtttggattgtctcattgaggttcacaaagaggaagag
ttagacagaataaaggatctaaagcccaagatcgtaggcgtaaactcacgggatttagac
aacttaaagatagacctatcaagaacaaaaaagatcctgtcccagatagagttcgatgcg
atcaggatcgcagaaagcggtataaaaaacaaaaaagacatagattttcttaaacaatat
tgcgatggctttctaatcggcgaaaccttactaaaaactcaggacataaacaaagccttt
gaggagctgttatga

DBGET integrated database retrieval system