KEGG   Hippea maritima: Hipma_1565Help
Entry
Hipma_1565        CDS       T01456                                 

Definition
Tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmr  Hippea maritima
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hipma_1565
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_1565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_1565
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hipma_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1541117..1542277
Genome map
AA seq 386 aa AA seqDB search
MKGYFGLYGGQFVAETLIPALDELEEAFNSFKKNKEAKEELNRYLKDYAGRSTPLYFAKN
LTNQLGVRVYLKREDLLHSGAHKINNTLGQIMLAKFMGKRRIIAETGAGQHGVATATAAA
ILGMECVVYMGEKDAQRQRPNLLRMKLLGAEVRIVKKGSRTLKSAINEALKDWVRNIKTT
HYLIGSVVGPHPFPKIVAYFQSIIGKEARRQILLKQKSLPDAVLACVGGGSNAIGIFKGF
LKDKGVELYGIEAGGEGLELGKHSAALTAGRPGIMHGALSYLLQNEDGQVAEVHSISAGL
DYPGVGPEHSFLKDSGRVRYGVCFDNEALEAFNMLSRLEGIIPALESSHALGYLIKNRES
FVNKTVIVNLSGRGDKDLPILEGIYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagggatattttggcctatacggagggcaatttgtagctgaaacactcataccggcc
ttggatgagcttgaggaggcttttaattcttttaaaaaaaacaaagaggcgaaagaggag
ttaaaccgatatctaaaggattatgcaggaaggtcaacgccactgtattttgcaaaaaac
ctaaccaatcagcttggggttagggtttatctaaaaagggaagacctgcttcattctggt
gcacacaagataaacaacaccttaggacagataatgctggcaaagtttatgggtaaaaga
cggatcatagcagaaacaggagctggtcagcacggcgttgcaacggccacagctgcagcc
atcttgggtatggagtgtgtggtttacatgggggagaaggatgctcaacgccaaaggcca
aacctgttgagaatgaaacttttaggggctgaggtaagaatagtaaaaaaaggcagcagg
accctaaaaagcgccatcaatgaagctttaaaggattgggttaggaatataaagaccaca
cactatttaataggcagcgttgttgggcctcacccgtttcctaaaatcgtagcctatttt
caatcaatcataggcaaagaggcaagaagacagatactcctaaagcaaaaaagcctccct
gatgctgttttagcctgcgttggcggtgggagcaacgcaataggcatattcaagggattc
ttaaaggataaaggcgttgagttatacggcattgaggcaggcggggagggtttggagtta
ggcaaacactcagcagccctaaccgcaggaagaccgggtattatgcatggtgcattgagc
tatcttttacaaaacgaggacggtcaggttgccgaagtccattccatctcagcaggcctt
gactatccaggcgttggacctgagcacagctttttaaaggattcaggcagggtgagatac
ggagtgtgctttgacaatgaggctttggaggcatttaacatgctgagccgccttgaaggt
attataccggcacttgagagctcgcatgctttaggatacctaataaaaaacagagaaagc
tttgtcaacaaaaccgtaatagtaaatctttccggcagaggcgataaggacttacccata
ctggagggcatttatgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system