KEGG   Hippea maritima: Hipma_1566Help
Entry
Hipma_1566        CDS       T01456                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hmr  Hippea maritima
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hipma_1566
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hipma_1566
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hipma_1566
Enzymes [BR:hmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hipma_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1542270..1542971
Genome map
AA seq 233 aa AA seqDB search
MCRIGIYLVCNYPNRDRFLDAVEMCNRYGIDFLEIGLPFSDPTADGDVIEKVSTETLKRY
SMSDFLDSTRLTRQLFKGKLYIMTYANIVFSYGIDKFACDLGFIDGLILADVPYREANRF
KKPLSKKGIGFVHFATPESRQKELERLKKDANDFIYFVSIRGTTGGRFHLDDETKEKLAY
LKGAKHGVILGFGIRNRSDIEKACRYADGVVIGTAAVEAVNGNFEAFLLSLKG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagaataggcatataccttgtgtgcaactatccaaacagggatagatttttggat
gctgtagagatgtgtaatagatacgggatcgattttttggagatcggcctgcctttttca
gacccaacggcagacggtgatgtgatcgaaaaagtctcaacggaaacgttaaaaagatac
agtatgtcggattttttagactcaacaagactaacaaggcagctcttcaagggcaaactc
tacataatgacctatgcaaacatcgtattttcatacggcatagataaatttgcctgtgat
ttaggcttcatcgatgggttaatactggccgatgtgccatacagggaagcaaataggttt
aaaaaacccctatcaaaaaaaggtataggttttgtgcattttgcaacaccagaaagcaga
caaaaagaattagaaagattaaaaaaagatgcaaacgactttatatactttgtttcaatc
agggggacaacgggcggtaggtttcaccttgatgatgaaacaaaagaaaaattagcatat
ctcaaaggggcaaaacatggggttattctgggttttggaataagaaacagaagcgatata
gaaaaggcctgcaggtatgcagacggtgttgttataggaacagccgctgttgaggcggtt
aatggaaattttgaagcctttcttttatcccttaagggctaa

DBGET integrated database retrieval system