KEGG   Hippea maritima: Hipma_1634Help
Entry
Hipma_1634        CDS       T01456                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K03431  
phosphoglucosamine mutase [EC:5.4.2.10]
Organism
hmr  Hippea maritima
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hmr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604759..1606117
Genome map
AA seq 452 aa AA seqDB search
MKLFGTDGIRGKANTYPMVGDVAYKLGKALVYALDGKTDRKRKIIIGKDTRLSGYMLESA
ITSGVVSMGADAYLVGPMPTPAIAFLVRSMRGDAGVVISASHNPYDDNGIKIFSKDGLKL
DDKLEDLIEKLILTDKLNNMGAVGDKIGRAYRIRDTLGRYIVFAKDTLPYSVSLDGLRVV
LDCANGATYKVAPMIFEELGAEVIAINNQPNGININDKCGSTYPKAIVDATKLYRADVGI
AFDGDGDRVLMVDDRYNIVDGDAILAILARYMKKRNTLKGDKVVGTVMTNYGLEMFLDKL
GISLQRVDVGDKNIVKKIMDENLNLGGEQSGHIVLWDFNTTGDGIVTALAILSIMKQENA
RLSELTQDFRKIPQKTVNVLVKEKPQLEEVEEIQNAITKAKEKLSKNGRIVVRYSGTEPL
LRITVESFEAALVDECLNLVSNAAVKSIGGKP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagctatttggaacagatggtataaggggaaaagccaatacatacccgatggtaggc
gatgtggcctataagttaggaaaggcacttgtatatgctttagatggcaaaacagacaga
aagagaaagataataataggtaaagatacaaggctttccggatacatgcttgagagtgct
attacaagcggtgttgtatccatgggagctgatgcataccttgttggtcctatgcctact
ccagccatagcatttctcgttaggagcatgcgtggtgatgccggtgttgtgatatctgca
agccataacccatacgacgataacggcataaaaatattttcaaaagatggactaaagctg
gatgacaaacttgaggatttgatagaaaaactgatactaaccgataaactcaataacatg
ggagcagttggtgataaaattggcagggcatacaggatcagggatacattgggtagatac
atagtatttgccaaagacaccctcccctacagcgtctctttggatgggctaagggtcgtt
ttagactgcgcaaacggcgctacctataaagtagctccaatgatattcgaagaattaggc
gctgaggtgatagcaataaacaatcaaccaaacggcataaacataaacgacaagtgtggc
tcaacctatccaaaggctatagttgatgcaactaagctctacagagcagatgtgggcatt
gcctttgatggtgatggtgacagggttttaatggtcgatgacagatacaacatagtagac
ggtgatgctatacttgccatacttgcaagatatatgaagaaacgcaataccttaaagggc
gacaaggtcgtaggcactgtaatgacaaattatggacttgagatgtttttagataaactg
ggcatatcgctacaaagggttgatgtaggcgacaaaaatattgttaaaaagataatggat
gaaaacttgaacttgggaggagaacaatcaggacatatagtcctatgggactttaacaca
actggagatggcattgttacagctttggccattctttcgataatgaaacaggaaaacgca
aggctctcagaacttacacaagatttcagaaaaatccctcaaaaaaccgttaacgtattg
gttaaggaaaaacctcaattggaagaggtagaagaaattcaaaatgcaataacaaaggca
aaagagaagctctcaaaaaacggcaggattgtggttagatactcaggcactgaaccgctt
ttgaggataactgttgaatcctttgaagctgccttagttgatgaatgcttaaatctggtg
tccaatgcagctgttaaatcgatagggggtaagccatga

DBGET integrated database retrieval system