KEGG   Helicobacter mustelae: HMU00760Help
Entry
HMU00760          CDS       T01191                                 

Definition
disulphide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hms  Helicobacter mustelae
Brite
Enzymes [BR:hms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HMU00760
Secretion system [BR:hms02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HMU00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102414..103157)
Genome map
AA seq 247 aa AA seqDB search
MKKISFIFLLSTLFLWAGTQENLKDLIKEKTKQDISIAKVYDLKGDNHLKIAILKDEATK
NQIPVITNKDGNLLFVLTNVFFSKNDEDSKFVEELLGKIQSDNDKQVNSAALNKLFESIP
EDYVIKLDSTTKNNKKVTYIVSDPMCPHCQEELRNIDKRLKDSNVYMVMVAYLGQESIKK
AATILAKVKDAKSTKDKIALFQQVYSIAYRPSSADSKAVKKVENITKKVADSALIKGVPF
IYEYTKQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatctcgtttatttttttactttctactttgtttctatgggcaggcacgcag
gagaatctcaaagacctcatcaaagaaaaaaccaaacaagatatttccatcgccaaggtt
tatgatctcaaaggggataaccatctaaaaatcgctattctcaaagatgaagccacaaaa
aaccaaatccctgttatcaccaataaggatgggaacttgctgtttgtactgacaaatgtg
ttttttagcaagaatgatgaggattccaaatttgtggaagaactgcttggcaaaatccaa
agcgataatgacaagcaggtgaactccgctgcgctcaataagctttttgaatccattcct
gaggattatgtcatcaagctagattccaccacaaaaaacaataaaaaagtcacctacatc
gtctctgatccgatgtgcccacactgtcaggaggaattgcgaaacatcgacaaacgccta
aaagacagcaatgtctatatggtgatggtggcatatcttggacaggaatccatcaaaaaa
gcagcaaccatcctagcaaaagtaaaagatgcaaaaagcaccaaggataaaattgcgctt
ttccagcaagtctactccatcgcctacagaccctcaagtgcagacagcaaggcggtcaaa
aaggtagaaaacatcaccaagaaagtggcagattctgcgctcatcaagggtgtgccattc
atctatgagtacacaaagcaataa

DBGET integrated database retrieval system