KEGG   Helicobacter mustelae: HMU01480Help
Entry
HMU01480          CDS       T01191                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hms  Helicobacter mustelae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMU01480 (folP)
Enzymes [BR:hms01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HMU01480 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187548..188717
Genome map
AA seq 389 aa AA seqDB search
MTQIKTLNPDFLPQAFARIGSDAMGCAIMGKKSQILAFEITHLSLSATLILKQEAIGVGG
DFATPRDCILARDAFYDGVLFGTKAQLQRLLNKLKTQPFGLGDLAKRLKAHLSQRKDFGT
QIMAVINLTPDSFFVDSRSNALDAKQKILSLLEMEVGMIDIGGASSRPGSQILEAEEELL
RLREVFDFIASQKLYLQKKFSIDTYNVEVAKAALDSGFAILNDVSGFQNPGMLELAASYK
ATVILMHTRGSPKEMQNLTNYEHLFGEMSAFFAEKITALKNMGVYDIILDIGFGFAKNLE
QNLDLIAHLRHFESFGLPLLVGASRKSTIQKILNKTPEDSLSGTLAMHFLALLNGANILR
VHDPLEHLDLLKIYQAYQHQQGETCISPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaataaaaaccctaaatcctgattttttgcctcaggcatttgcgcgcattggc
agtgatgctatgggatgtgcaatcatgggtaaaaaatcccaaatcctagcctttgagatt
acgcatctttctttgagtgccaccctcattttgaagcaagaggccattggtgtgggtggg
gattttgccactccaagggattgcattctagcaagggatgctttttatgatggtgtgctt
tttggcacaaaggcacagctccaaagactgctaaacaaactcaaaacccagccctttggg
ttaggggatctagcaaagagactcaaggctcatctatcccagcgcaaagactttggcaca
cagattatggcagtgattaatctcacgcccgatagtttttttgtggattcaagatcaaac
gccctggatgccaaacaaaaaatcctctctttgcttgagatggaagtggggatgattgac
attggaggtgcgagctctcgcccgggcagtcagattctagaggcagaggaggagcttttg
cgcttgagggaggtttttgattttattgcttctcaaaagctttatttacaaaagaaattt
tccatcgacacctataatgtcgaggtagcaaaagcggcgcttgatagtggctttgccatc
ctcaatgatgttagtggtttccaaaaccccgggatgctagagcttgcagctagttataag
gctacagtgattttgatgcatacaagaggcagtccaaaagaaatgcaaaatctcacaaat
tatgagcatctttttggggagatgagtgcgttttttgcagaaaaaatcacggcactcaaa
aacatgggggtctatgacatcatcctagacattggttttggttttgccaaaaatttggag
caaaatctagatctcatcgcccaccttaggcattttgagagttttggcctccccttgctt
gttggggcaagccgcaagagcactatccaaaaaattcttaacaagactccagaggatagc
ctaagcgggaccttggccatgcattttttggcgcttttgaatggcgcaaatatcttgcgt
gtgcatgatcccttggagcatttggatctgctaaagatctatcaagcctatcagcatcag
caaggagagacatgcataagccctctgtaa

DBGET integrated database retrieval system