KEGG   Helicobacter mustelae: HMU01480Help
Entry
HMU01480          CDS       T01191                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hms  Helicobacter mustelae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hms00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187548..188717
Genome map
AA seq 389 aa AA seqDB search
MTQIKTLNPDFLPQAFARIGSDAMGCAIMGKKSQILAFEITHLSLSATLILKQEAIGVGG
DFATPRDCILARDAFYDGVLFGTKAQLQRLLNKLKTQPFGLGDLAKRLKAHLSQRKDFGT
QIMAVINLTPDSFFVDSRSNALDAKQKILSLLEMEVGMIDIGGASSRPGSQILEAEEELL
RLREVFDFIASQKLYLQKKFSIDTYNVEVAKAALDSGFAILNDVSGFQNPGMLELAASYK
ATVILMHTRGSPKEMQNLTNYEHLFGEMSAFFAEKITALKNMGVYDIILDIGFGFAKNLE
QNLDLIAHLRHFESFGLPLLVGASRKSTIQKILNKTPEDSLSGTLAMHFLALLNGANILR
VHDPLEHLDLLKIYQAYQHQQGETCISPL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaataaaaaccctaaatcctgattttttgcctcaggcatttgcgcgcattggc
agtgatgctatgggatgtgcaatcatgggtaaaaaatcccaaatcctagcctttgagatt
acgcatctttctttgagtgccaccctcattttgaagcaagaggccattggtgtgggtggg
gattttgccactccaagggattgcattctagcaagggatgctttttatgatggtgtgctt
tttggcacaaaggcacagctccaaagactgctaaacaaactcaaaacccagccctttggg
ttaggggatctagcaaagagactcaaggctcatctatcccagcgcaaagactttggcaca
cagattatggcagtgattaatctcacgcccgatagtttttttgtggattcaagatcaaac
gccctggatgccaaacaaaaaatcctctctttgcttgagatggaagtggggatgattgac
attggaggtgcgagctctcgcccgggcagtcagattctagaggcagaggaggagcttttg
cgcttgagggaggtttttgattttattgcttctcaaaagctttatttacaaaagaaattt
tccatcgacacctataatgtcgaggtagcaaaagcggcgcttgatagtggctttgccatc
ctcaatgatgttagtggtttccaaaaccccgggatgctagagcttgcagctagttataag
gctacagtgattttgatgcatacaagaggcagtccaaaagaaatgcaaaatctcacaaat
tatgagcatctttttggggagatgagtgcgttttttgcagaaaaaatcacggcactcaaa
aacatgggggtctatgacatcatcctagacattggttttggttttgccaaaaatttggag
caaaatctagatctcatcgcccaccttaggcattttgagagttttggcctccccttgctt
gttggggcaagccgcaagagcactatccaaaaaattcttaacaagactccagaggatagc
ctaagcgggaccttggccatgcattttttggcgcttttgaatggcgcaaatatcttgcgt
gtgcatgatcccttggagcatttggatctgctaaagatctatcaagcctatcagcatcag
caaggagagacatgcataagccctctgtaa

DBGET integrated database retrieval system