KEGG   Helicobacter mustelae: HMU02300Help
Entry
HMU02300          CDS       T01191                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hms  Helicobacter mustelae
Pathway
hms00230  Purine metabolism
hms01100  Metabolic pathways
Module
hms_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HMU02300 (gmk)
Enzymes [BR:hms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HMU02300 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 AAA_16 AAA_17 Rad17 AAA_5 ABC_tran AAA_29 CPT dNK RsgA_GTPase T2SSE AAA_14 RNA_helicase AAA Cytidylate_kin PduV-EutP AAA_28 NB-ARC Zeta_toxin AAA_PrkA NACHT MMR_HSR1 Mg_chelatase AAA_23
Motif
Other DBs
NCBI-ProteinID: CBG39492
UniProt: D3UG71
Position
complement(281620..282219)
Genome map
AA seq 199 aa AA seqDB search
MQKMLILSGPSGSGKSTLYQVLKKEFPHLYFSISTTTRIPREGEQHGREYFFVTKEDFLQ
DVKNDRFLEWAQVHQNYYGTSKKPIEQALLEGRLIVFDVDVQGHRNIKKYYPFAKSVFIT
TPTDLILKQRLQQRQSESKQDLEHRLGHAYKEMEAVGEFDFLIINDDIKKASKQILGIAH
GMDCCNFDALELMRTWKTN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatgctcatcctctcagggcctagtggcagcggaaaaagtacgctgtatcag
gttttaaaaaaagaatttccccatctttatttttctatctcaactacaacaaggatacca
agagaaggcgagcagcatggcagggagtacttttttgtcaccaaagaagattttctgcaa
gatgtcaaaaatgatagatttttggaatgggcacaggtgcatcaaaactattatggaacc
tcaaaaaaacccatagaacaagctctcttagaggggagattaattgtttttgatgtggat
gttcaagggcatcgcaatatcaaaaaatactatcccttcgcaaaatctgtattcatcacc
acccccacggatttaattttaaaacaacgattgcagcagcgccagagcgaaagcaagcaa
gacttggagcatcgattgggacatgcctacaaagaaatggaagctgtgggggaatttgat
tttttaatcatcaatgatgacattaaaaaagcctccaagcaaattttgggaattgcgcat
gggatggattgctgcaattttgatgcactagagctaatgcgtacttggaaaacaaattaa

DBGET integrated database retrieval system