KEGG   Helicobacter mustelae: HMU03640Help
Entry
HMU03640          CDS       T01191                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hms  Helicobacter mustelae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMU03640 (galU)
   00052 Galactose metabolism
    HMU03640 (galU)
   00500 Starch and sucrose metabolism
    HMU03640 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMU03640 (galU)
Enzymes [BR:hms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMU03640 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421564..422385
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPILDKPLIQYGVEEAMQAGCHTMAIVTGRTKR
AIEDHFDISYEIEHQIQGTEKEAHLKELRQVMDQCTFSYTRQNKMLGLGHAILTGEALIG
NEAFAVILADDLCVNQEEGVLAQMVKLYERHQCSIVAIEEVEAEQIDKYGVIAGKEIEQN
VYRVDFMVEKPRREEAPSNLAVIGRYILTPDIFDILRITEPGKKGEIQITDALMKQAKAG
RVLAYKFRGKRYDCGSIAGFVEATNALYQKIQG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaatgtttattccccgccgcaggatatgggacgagatttttgcctgcaaca
aaggccatgccaaaggagatgctacccatcctagataagcctctaatccagtatggggtg
gaggaagccatgcaggcaggatgtcatacgatggcaattgtcacaggtcgcaccaagcgc
gccattgaagatcattttgatattagctatgagattgagcaccagattcagggcacggaa
aaagaagcccatctcaaggagttgcgccaagtcatggatcagtgtaccttttcatacacg
cgacaaaataaaatgctagggcttgggcatgcgatcctcacaggagaggcattgattggc
aatgaagcatttgcggtgattttggcagatgatttgtgtgtgaatcaagaagaaggagtg
ctagcgcagatggtgaagctttatgaacgtcatcaatgcagcattgtggccattgaagag
gtggaggcagaacaaattgacaaatatggagtgatcgcaggtaaggaaattgagcagaat
gtctatcgggtggatttcatggtagaaaaacctaggcgtgaagaggctcctagtaatttg
gcagtgattgggcgctatattttaactcctgatatttttgatatcttgcgcatcactgag
cctggcaaaaagggtgagattcagattacggatgcgttgatgaagcaggcaaaggcagga
agggtgctggcttataaattcagaggcaagcgttatgattgcgggagtattgctggtttt
gtagaggccaccaatgccctctatcaaaaaatccaaggctaa

DBGET integrated database retrieval system