KEGG   Helicobacter mustelae: HMU04200Help
Entry
HMU04200          CDS       T01191                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hms  Helicobacter mustelae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMU04200 (ruvA)
Enzymes [BR:hms01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMU04200 (ruvA)
DNA repair and recombination proteins [BR:hms03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HMU04200 (ruvA)
    RecFOR pathway proteins
     HMU04200 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(483707..484261)
Genome map
AA seq 184 aa AA seqDB search
MIFALKGKVFALEPAKLLLDVHDVIYEIHISFGSAEELQGKEEALVYISQIIREDAHLLF
GFVTPMEKQIFDTLIKINGVGPKVALAILSTFSAQEFMAVIERKDIAALQKVPGVGTKSA
GKIMVELSGAYVELLPKKDHTEHFQQAEMALENLGYKRAAIQKALKSIKASNVQDIIKEA
LKLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgcattgaagggcaaggtttttgcattagaacccgcaaaattattgcttgat
gtgcatgatgtaatctatgaaatccatatttcttttggtagcgcagaggagctgcaaggc
aaggaggaggccttggtgtatatcagtcaaatcatccgtgaggatgcgcatttgcttttt
ggctttgtcacgccaatggagaagcaaatttttgacaccctgataaaaatcaatggcgta
ggcccaaaggtcgcgctcgcaatcctttcaaccttcagtgcacaggaatttatggcagtc
attgagcgcaaagacatcgctgcactccaaaaggtaccaggagtaggcacaaagagcgcg
ggtaagattatggtagagctatctggggcatatgtcgagctcctacccaaaaaagatcac
acagagcatttccagcaagcagaaatggccctagaaaacctaggttataagagggctgcg
atccaaaaagcacttaaaagcatcaaggctagcaatgtgcaagacatcatcaaagaggca
ctaaaacttttataa

DBGET integrated database retrieval system