KEGG   Helicobacter mustelae: HMU04200Help
Entry
HMU04200          CDS       T01191                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hms  Helicobacter mustelae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hms00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMU04200 (ruvA)
Enzymes [BR:hms01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMU04200 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(483707..484261)
Genome map
AA seq 184 aa AA seqDB search
MIFALKGKVFALEPAKLLLDVHDVIYEIHISFGSAEELQGKEEALVYISQIIREDAHLLF
GFVTPMEKQIFDTLIKINGVGPKVALAILSTFSAQEFMAVIERKDIAALQKVPGVGTKSA
GKIMVELSGAYVELLPKKDHTEHFQQAEMALENLGYKRAAIQKALKSIKASNVQDIIKEA
LKLL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgcattgaagggcaaggtttttgcattagaacccgcaaaattattgcttgat
gtgcatgatgtaatctatgaaatccatatttcttttggtagcgcagaggagctgcaaggc
aaggaggaggccttggtgtatatcagtcaaatcatccgtgaggatgcgcatttgcttttt
ggctttgtcacgccaatggagaagcaaatttttgacaccctgataaaaatcaatggcgta
ggcccaaaggtcgcgctcgcaatcctttcaaccttcagtgcacaggaatttatggcagtc
attgagcgcaaagacatcgctgcactccaaaaggtaccaggagtaggcacaaagagcgcg
ggtaagattatggtagagctatctggggcatatgtcgagctcctacccaaaaaagatcac
acagagcatttccagcaagcagaaatggccctagaaaacctaggttataagagggctgcg
atccaaaaagcacttaaaagcatcaaggctagcaatgtgcaagacatcatcaaagaggca
ctaaaacttttataa

DBGET integrated database retrieval system