KEGG   Helicobacter mustelae: HMU04980Help
Entry
HMU04980          CDS       T01191                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU04980 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU04980 (glk)
   00052 Galactose metabolism
    HMU04980 (glk)
   00500 Starch and sucrose metabolism
    HMU04980 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HMU04980 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMU04980 (glk)
   00524 Butirosin and neomycin biosynthesis
    HMU04980 (glk)
Enzymes [BR:hms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMU04980 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573366..574370
Genome map
AA seq 334 aa AA seqDB search
MSITQNKGKELYPRLLADIGGTNARFALELSKSKIEHIEVLACNDYNTIVDAVKAYLSKV
GNPVVNYGAFAIANPVVGDWVQMTNHHWAFSIETTRQALDLEVLILINDFTAQAHAISRM
PLSELVQIGGNSCAIHAPKAVLGPGTGLGVSGLIPCLDSYIALAGEGGHTTFAPFDDTEV
MIWQYAKKKFGHVSVERFLSGSGLCLIYEALSHREGMKNSKMTPELISEQALSGKFPLSR
LTLDIFCAMLGTVASDLALTLGARGGVYLCGGIIPKIIEYFKNSPFRTRFENKGRFDAYL
AAIPVYVVLAKYPGIHGVAVALENYLKDYFKNKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctattactcaaaataaaggcaaggaactctatcctaggttattggctgatattggc
ggaacaaatgcgagatttgccctagagcttagcaagtctaaaatcgagcatattgaggtt
ttggcctgcaatgattacaataccattgtggatgctgtgaaggcgtatttatccaaggtg
gggaatccggtggtcaattatggcgcttttgccatcgctaatcccgtggtgggggattgg
gtgcagatgacaaatcatcattgggctttttctatcgaaactaccaggcaggctcttgat
ttagaagtcttgattttaatcaatgactttaccgctcaagctcatgctattagtagaatg
cccctatcagagcttgtgcaaattggaggcaattcttgtgcgattcatgcaccaaaggcg
gttttgggtccagggactggacttggagtgagtggactcatcccttgcctagatagctat
attgccctagcaggagagggggggcatacgacttttgcgccctttgatgatactgaggta
atgatctggcaatatgctaagaaaaaatttggacatgtttctgtggagagatttttgagc
ggatcggggctttgcctcatttatgaagctctctctcatcgagaaggtatgaaaaactca
aaaatgactccagagctcatcagcgagcaggctctaagtggaaaattcccactcagtcgt
ctgacgctagatatattttgcgcgatgcttggaacggttgcttctgacctggccttgacc
ttgggagcaaggggtggggtctatctttgtggaggaatcatcccaaaaatcattgaatac
ttcaaaaactctcctttcaggacgcgttttgaaaacaagggcaggtttgatgcatatttg
gccgctatccctgtttatgtggtattggccaaatatcctggcattcatggcgtggccgtg
gcccttgaaaactatttgaaagattattttaaaaataaaggctaa

DBGET integrated database retrieval system