KEGG   Helicobacter mustelae: HMU05400Help
Entry
HMU05400          CDS       T01191                                 

Definition
pyruvate ferredoxin oxidoreductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU05400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05400
   00020 Citrate cycle (TCA cycle)
    HMU05400
   00620 Pyruvate metabolism
    HMU05400
   00640 Propanoate metabolism
    HMU05400
   00650 Butanoate metabolism
    HMU05400
  Energy metabolism
   00680 Methane metabolism
    HMU05400
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05400
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623055..623615
Genome map
AA seq 186 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVVAGKGKQVQAFAFYGSAKRGTAMTAYNRVDESPILN
HEKFMQPDYVLVIDPGLPFIVDICAHEKPDTKYIITTHLSKEELLQKKPELQGKQVYTLD
CIKISLDTIGKPIPNAPMLGALMKVSKILELDYFLEAFIKLLGKKLPQKIIDANKEAIVR
AYNEVK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattcgatggcattctcgggctggtcaaggggcagttacgggtgcaaaaggt
ttggcagatgtagtggcaggtaaggggaagcaggtacaggcctttgctttttatggttct
gccaaaagaggaacggcgatgactgcgtataatcgcgtggatgaatctcccatattaaat
cacgagaagtttatgcaaccagattatgttttggtcattgatccgggtttgccttttatc
gtagatatttgcgcccatgagaagccagatactaagtatattatcactacacatttgagc
aaggaagaattactgcaaaaaaaaccagaattgcagggcaagcaggtttataccctggat
tgcatcaaaatctctttggataccattggaaagcctatccccaatgccccaatgctaggc
gcattgatgaaggtttccaagattttggaattggattattttttggaagcgtttattaag
cttttggggaaaaagctcccgcaaaaaatcatcgatgcgaacaaagaagcgattgttcga
gcttataacgaagtaaaataa

DBGET integrated database retrieval system