KEGG   Helicobacter mustelae: HMU05410Help
Entry
HMU05410          CDS       T01191                                 

Definition
pyruvate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU05410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05410
   00020 Citrate cycle (TCA cycle)
    HMU05410
   00620 Pyruvate metabolism
    HMU05410
   00640 Propanoate metabolism
    HMU05410
   00650 Butanoate metabolism
    HMU05410
  Energy metabolism
   00680 Methane metabolism
    HMU05410
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05410
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623626..624024
Genome map
AA seq 132 aa AA seqDB search
MDDKKGWNEFEIGSVLFPFEENGMEAQEKMRADRSYTQNSSRTASVSHWRVQKPVHNHDH
CINCFFCWVYCPDASIVAKDDQMSGVDYMHCKGCGVCVSVCPTNPKSLLMFDEYESNEDA
IKQWPKKEAKQK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaaaaaggttggaatgaatttgaaattggttcagtgttgtttccatttgaa
gaaaatggcatggaagcacaggagaaaatgagagctgatagatcctacacacaaaatagc
tcaagaactgcaagtgtctcacattggagagtgcaaaaacccgtgcataatcacgatcat
tgtatcaattgttttttttgctgggtgtattgcccagatgcctctatcgtggccaaagat
gatcaaatgagtggggtggattatatgcattgcaagggttgtggtgtttgtgtttctgtt
tgtccaaccaatcccaagtcgcttttgatgtttgatgaatatgaaagcaatgaagatgca
attaaacaatggcctaaaaaagaagcaaaacagaaataa

DBGET integrated database retrieval system