KEGG   Helicobacter mustelae: HMU05420Help
Entry
HMU05420          CDS       T01191                                 

Definition
pyruvate-flavodoxin oxidoreductase
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU05420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05420
   00020 Citrate cycle (TCA cycle)
    HMU05420
   00620 Pyruvate metabolism
    HMU05420
   00640 Propanoate metabolism
    HMU05420
   00650 Butanoate metabolism
    HMU05420
  Energy metabolism
   00680 Methane metabolism
    HMU05420
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05420
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624036..625259
Genome map
AA seq 407 aa AA seqDB search
MALKYELSKVEVWDGNMAASHALRQAQVDVVAAYPITPSTPIVQNYGKFVSDGYVDGEFV
MVESEHAAMSACVGAAAAGGRVATATSSQGFALMVEVLYQGSGMRVPLVLNLVNRALASP
LNVNGDHSDMYLSRDCGWISLCAFNPQEAYDFNLMAFKIGEDLRVRIPVIVNQDGFICSH
TAQNVAPLSDEEAYAFVGDYQQKNAMLNFAKPVTYGSQAEEDWHFEHKAQLHHDLMHSSA
VIEEVFELFAKKTGRKYNLVEKYDMEDAEVAIVAIGTTVESARIAAHQARKEGIKAGVVS
FHTLRPFPYKLVGEALKHCKAIAMLDRSSPAGAMGMLFNEVGVAVLDSAENHNPILSNYI
YGLGGRDITQNDLLGVYKDLDASLKAGKLTHPRQQFIGLRGKAMAFN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaaatatgaattatcaaaagtagaggtatgggatggaaacatggcggcaagc
catgcgttgagacaggctcaggttgatgttgtagcagcatatcctatcactccctctact
cctattgtgcaaaactatggaaaatttgtaagcgatggttatgttgatggcgagtttgtg
atggtggaatctgaacatgctgctatgagtgcgtgtgtgggcgctgctgctgctggtggt
agggtggcgacagcgacaagttctcaggggtttgcattgatggtggaggtgctctatcag
ggatcgggcatgcgtgttcccctggtgctcaatcttgtcaatcgtgcgctcgcatctccg
ctcaatgtcaatggcgatcattctgatatgtatttgagtagagactgtggatggattagc
ctttgtgcctttaatcctcaagaagcttatgatttcaatcttatggcatttaaaatcggg
gaggatttgcgcgtaagaatcccagtgattgtaaatcaggatgggtttatttgttctcat
acggcccaaaatgtcgcacctttgagtgatgaggaggcctatgcttttgttggggattat
cagcaaaaaaatgccatgcttaacttcgctaagcccgtgacctatggatcgcaggcagag
gaagattggcattttgaacataaggcccagctccatcatgatctcatgcattcttctgca
gtgattgaggaggtttttgagctctttgctaaaaaaactggtaggaaatataatctagta
gaaaagtatgacatggaggatgcggaagtggcgattgtggctattggcacgactgtagaa
tctgctagaattgcagcgcatcaagcaagaaaagaggggatcaaagcgggtgtggtgtct
ttccatacattgagacccttcccctataaacttgtaggagaggcactcaagcactgcaag
gccattgccatgctagatcgcagttcaccagcaggcgccatgggcatgctctttaatgaa
gtgggggtggcagtgctagatagcgcagaaaatcacaatcctattttgtccaattatatc
tatggccttggtggacgtgacatcacgcagaatgatcttttgggagtttataaagatctt
gatgccagtttaaaggcaggaaaactcacacatcccagacagcagtttatcggacttcgc
ggtaaagcaatggcttttaattga

DBGET integrated database retrieval system