KEGG   Helicobacter mustelae: HMU05420Help
Entry
HMU05420          CDS       T01191                                 

Definition
(GenBank) putative pyruvate-flavodoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
hms00010  Glycolysis / Gluconeogenesis
hms00020  Citrate cycle (TCA cycle)
hms00620  Pyruvate metabolism
hms00640  Propanoate metabolism
hms00650  Butanoate metabolism
hms00680  Methane metabolism
hms01100  Metabolic pathways
hms01120  Microbial metabolism in diverse environments
hms01130  Biosynthesis of antibiotics
hms01200  Carbon metabolism
Module
hms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05420
   00020 Citrate cycle (TCA cycle)
    HMU05420
   00620 Pyruvate metabolism
    HMU05420
   00640 Propanoate metabolism
    HMU05420
   00650 Butanoate metabolism
    HMU05420
  Energy metabolism
   00680 Methane metabolism
    HMU05420
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05420
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CBG39803
UniProt: D3UH31
Position
624036..625259
Genome map
AA seq 407 aa AA seqDB search
MALKYELSKVEVWDGNMAASHALRQAQVDVVAAYPITPSTPIVQNYGKFVSDGYVDGEFV
MVESEHAAMSACVGAAAAGGRVATATSSQGFALMVEVLYQGSGMRVPLVLNLVNRALASP
LNVNGDHSDMYLSRDCGWISLCAFNPQEAYDFNLMAFKIGEDLRVRIPVIVNQDGFICSH
TAQNVAPLSDEEAYAFVGDYQQKNAMLNFAKPVTYGSQAEEDWHFEHKAQLHHDLMHSSA
VIEEVFELFAKKTGRKYNLVEKYDMEDAEVAIVAIGTTVESARIAAHQARKEGIKAGVVS
FHTLRPFPYKLVGEALKHCKAIAMLDRSSPAGAMGMLFNEVGVAVLDSAENHNPILSNYI
YGLGGRDITQNDLLGVYKDLDASLKAGKLTHPRQQFIGLRGKAMAFN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaaatatgaattatcaaaagtagaggtatgggatggaaacatggcggcaagc
catgcgttgagacaggctcaggttgatgttgtagcagcatatcctatcactccctctact
cctattgtgcaaaactatggaaaatttgtaagcgatggttatgttgatggcgagtttgtg
atggtggaatctgaacatgctgctatgagtgcgtgtgtgggcgctgctgctgctggtggt
agggtggcgacagcgacaagttctcaggggtttgcattgatggtggaggtgctctatcag
ggatcgggcatgcgtgttcccctggtgctcaatcttgtcaatcgtgcgctcgcatctccg
ctcaatgtcaatggcgatcattctgatatgtatttgagtagagactgtggatggattagc
ctttgtgcctttaatcctcaagaagcttatgatttcaatcttatggcatttaaaatcggg
gaggatttgcgcgtaagaatcccagtgattgtaaatcaggatgggtttatttgttctcat
acggcccaaaatgtcgcacctttgagtgatgaggaggcctatgcttttgttggggattat
cagcaaaaaaatgccatgcttaacttcgctaagcccgtgacctatggatcgcaggcagag
gaagattggcattttgaacataaggcccagctccatcatgatctcatgcattcttctgca
gtgattgaggaggtttttgagctctttgctaaaaaaactggtaggaaatataatctagta
gaaaagtatgacatggaggatgcggaagtggcgattgtggctattggcacgactgtagaa
tctgctagaattgcagcgcatcaagcaagaaaagaggggatcaaagcgggtgtggtgtct
ttccatacattgagacccttcccctataaacttgtaggagaggcactcaagcactgcaag
gccattgccatgctagatcgcagttcaccagcaggcgccatgggcatgctctttaatgaa
gtgggggtggcagtgctagatagcgcagaaaatcacaatcctattttgtccaattatatc
tatggccttggtggacgtgacatcacgcagaatgatcttttgggagtttataaagatctt
gatgccagtttaaaggcaggaaaactcacacatcccagacagcagtttatcggacttcgc
ggtaaagcaatggcttttaattga

DBGET integrated database retrieval system