KEGG   Helicobacter mustelae: HMU05430Help
Entry
HMU05430          CDS       T01191                                 

Definition
pyruvate-flavodoxin oxidoreductase
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU05430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU05430
   00020 Citrate cycle (TCA cycle)
    HMU05430
   00620 Pyruvate metabolism
    HMU05430
   00640 Propanoate metabolism
    HMU05430
   00650 Butanoate metabolism
    HMU05430
  Energy metabolism
   00680 Methane metabolism
    HMU05430
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMU05430
Enzymes [BR:hms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMU05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625270..626214
Genome map
AA seq 314 aa AA seqDB search
MTKEIKNLKQFQKSAEKFEGANLLCPGCAHGMIIREILNVVEGPMVIGNSTGCIEVSTAV
YPYTSWDVPWIHIGFENGSTAVAGVETMYKALAKKGKYQGQKPRFIAFGGDGATYDIGFQ
WISGCFERGHDITYVCFDNEVYANTGGQRSGSTPIGSSTSTTPAGKVSYGKKERKKDMLA
IMASHGSPYVAQVAPNKWKDMNKKIKQAIDAEGPTFINALSACTTEWRFDSHSTVDIMDL
AVDSLVFPLYEIVNGNELNITYRPKNIIPVRDYLGAQGRFKHLFKPENEHIIEQFQKDVD
KKWEFLQRREEARV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaatcaaaaatctaaaacaatttcaaaaatcagcagaaaaatttgaaggt
gccaatctcctttgtccgggctgtgctcatgggatgattatccgagagatccttaatgtg
gtagaggggccaatggtgattggaaattctacaggatgtatcgaagtatccactgctgtg
tatccctatacttcttgggatgtgccctggattcacattggatttgagaatggatccact
gctgtggcaggcgtggagaccatgtacaaggcgcttgcaaaaaaaggaaaatatcagggg
caaaaacctcgatttattgcatttggtggagatggtgcgacttatgatattggattccag
tggatcagcggctgctttgagagaggacatgacatcacttatgtatgttttgacaatgaa
gtctatgccaataccggtgggcaaagaagcggatctactcccataggatcttctacctct
accactccagcaggcaaggtgagctatggcaaaaaagaaagaaaaaaagacatgcttgcc
atcatggcatcccatggctctccttatgtcgcgcaagtcgctcccaacaaatggaaggac
atgaacaaaaaaatcaagcaggctatcgatgcagagggccccaccttcatcaatgctttg
agtgcttgcacaacagaatggagatttgattctcatagcactgtggatatcatggatcta
gcagtggattccttggtgtttcctctttatgagattgtcaatggaaatgagctaaacatc
acctatcgtcccaaaaacatcattcctgtgagagattatttgggcgcgcagggtagattt
aaacatctcttcaagcctgagaatgaacatatcatcgagcaatttcaaaaagatgttgat
aagaagtgggagtttttgcagcgcagagaagaggctagggtataa

DBGET integrated database retrieval system