KEGG   Helicobacter mustelae: HMU05750Help
Entry
HMU05750          CDS       T01191                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hms  Helicobacter mustelae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMU05750 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMU05750 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMU05750 (trpA)
Enzymes [BR:hms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMU05750 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(664383..665114)
Genome map
AA seq 243 aa AA seqDB search
MNIALMGHIIGGYPSQAQSIESALGIIEGGAQYLEVQFPFSDPSADGEIIEHACNLALQN
GFKVQQGFEIIEALSKKAQILIMTYANIIFRYGIEGFLKQAKRSGAKALIIPDLPLHQDE
GLRAHAKKMGIFVIELITPNMSDARMKEITQQSNCPYLYAVARLGITGSKTTIDDALERY
IARIRKNSNQKIALGFGIQTHEQIEQIKDSVDIIVAGSYFVRQIKQNPTKQALYLHTKKL
LEG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgcattgatgggacatatcatagggggctatcccagccaagctcaaagcatc
gaatctgctcttggcatcattgagggaggggcacaatatctagaagtccaattccccttt
tctgaccccagcgctgatggagagattattgagcacgcatgcaatctcgcgctacaaaat
ggcttcaaagtgcaacaggggtttgaaatcatagaagcgctaagtaaaaaggctcaaatc
cttatcatgacttatgcaaatattatttttcgctatgggatagagggttttctcaagcag
gccaaacgctctggagccaaggcattgatcatccctgatttgcctctgcaccaggatgaa
ggtctccgcgcccatgccaagaaaatgggtatttttgtcatagaactcattacccctaat
atgagtgatgcgcgcatgaaagaaattactcagcagagcaactgcccctacctctatgct
gtggctaggcttgggatcacgggctcaaaaaccaccatcgatgatgcgctagagcgctac
attgctcgcattcgcaaaaactccaaccaaaaaatcgcactgggatttgggatacagact
catgagcaaattgaacaaatcaaagactctgtagacatcattgttgcagggagttatttc
gtgcgccaaatcaagcaaaatcccacaaaacaagccctctatctgcataccaaaaaactc
ctagagggatga

DBGET integrated database retrieval system