KEGG   Helicobacter mustelae: HMU07920Help
Entry
HMU07920          CDS       T01191                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.-)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hms  Helicobacter mustelae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hms00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(920298..921395)
Genome map
AA seq 365 aa AA seqDB search
MVLLGSTGSIGVQTLSIAKLWNLEVEVLCAGRNIPLLNEQIAIHRPKIVVIQDRNDATNL
KALGARVLFGDEGILQAIADSCSKLVVNALVGLSGLAPSLEAKKQKKTLALANKESLVSG
GWLLQDYPIIPVDSEHFGIWYLLSTHPRHSIQKLCITASGGAFRDTPIQDIATKKPEDAL
CHPNWKMGNKITIDSATMVNKLFELLEAKWLFGIENLDALIERSSIVHAIVSFKDGSSIA
HFANPDMALPISYALNPIRAKQECLTPALDFCSLKAIAFEEISPLRYPIWEAREMILQNP
RLGAALNSANDILVVAFLEQSICFGEISRGILSVLEHFASQTPNSLQEIFTLHQEIQIFL
QCREK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtactactaggcagcacgggatccattggggtgcaaaccctaagcatcgcaaaatta
tggaatcttgaggtggaggttttgtgcgcggggaggaacatccccctactcaatgagcaa
atcgccatccaccgaccaaaaatcgttgtaatccaagacagaaatgacgccacaaatctc
aaagcactgggtgcgcgtgtactctttggagatgaggggattttgcaagcgattgcagat
tcttgctccaaacttgttgtaaatgcacttgttggattatcaggacttgctccaagtcta
gaagcaaagaagcagaaaaaaaccctagcgctcgccaacaaagaaagcctggtaagcggg
ggttggctattgcaagattatcccatcatcccagtggatagcgagcattttgggatttgg
tatcttttaagcacgcatcccaggcacagcattcaaaagctttgtatcaccgcaagcgga
ggggcatttcgcgacactcccatacaagacattgccacaaaaaaaccagaagacgccctg
tgtcatcccaactggaaaatgggaaataaaatcaccattgattctgccacgatggtcaat
aagctttttgaattactcgaggcaaaatggctctttgggatagagaatctggatgcgttg
attgagcgcagctccattgtccatgcgattgtgagctttaaggatggctcctctatcgcg
cattttgcaaatcctgatatggcattgcccatctcctatgcactcaatcccattcgtgca
aagcaagagtgtctcacccctgcgctagatttttgcagtctcaaagccattgcatttgaa
gaaatctctcccctacgctatcccatctgggaggcacgcgaaatgattttgcaaaatcca
aggcttggagcagcgctaaatagtgctaatgatattctggtagtagcatttttggagcaa
agcatctgctttggtgagatttctagagggattttatctgtgcttgagcattttgcgtct
caaaccccaaattctttgcaagaaatttttacactgcatcaagaaatccaaatctttctc
caatgcagagaaaagtag

DBGET integrated database retrieval system