KEGG   Helicobacter mustelae: HMU08250Help
Entry
HMU08250          CDS       T01191                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hms  Helicobacter mustelae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hms01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hms00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(959868..961205)
Genome map
AA seq 445 aa AA seqDB search
MQATEILQRLITYPTITPKECGIYAQITQILGDFEVIALDKNQIKNLFCYRVFGSQNSSE
QEDSLALSASKNLGQNLKNSKNPTESAANAQKQNGDTTLKNPAINNLRDFSALAKLPHLC
FAGHVDVVPPGEGWGSDPFVPLQKEGKIYGRGAQDMKGGIAGFLAAILQAKKALMSSKSP
KILSVLLTSDEEGVGIDGTRYVLEFLAQKGFLPTFAIVAEPTCNLKMGDVIKIGRRGSIN
GELLIKGKQGHVAYPEKCKNPTEILGARLGRLAGVDLDSGDESFAPSKLVITDIRGGIEA
VNVTPNSLKILFNVRNNTKTTKQDIQKYISSVLEGVEHELTLKQSSHPFLSPKEGYIAQK
MQDCIQEILKISPELSTSGGTSDARFFAKYGIEVVEFGVKNDRIHGIDECVEIADLEALC
AIFARLVTKFAQDKILEKNLILQKE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctactgagattttgcaaaggctgattacctatcccaccatcacgccaaaagaa
tgcgggatttatgcgcaaatcacgcagattttgggggattttgaagtgattgcactagat
aaaaaccagatcaaaaatctcttttgctaccgagtctttggtagccaaaactcgtccgag
caagaagattccctagcactttctgctagcaaaaatcttggccaaaatctaaaaaattct
aaaaaccctaccgaaagcgccgcaaatgcacaaaaacaaaatggtgacacaacgctaaaa
aatcctgccattaacaatctcagagacttttctgcgctagcaaagctaccgcatctgtgc
tttgcaggccatgttgatgtagtacccccaggggagggctgggggagcgatccttttgtg
ccattgcaaaaggagggcaagatctatggcaggggtgcgcaagatatgaagggcgggatt
gcgggatttttggctgccatcttgcaggcaaaaaaagcccttatgtcttcaaaatccccc
aaaatcctctctgtgctgcttacaagcgatgaggaaggagtggggattgatggcacgcgc
tatgtgctagaattcctcgcacaaaaaggatttttgcccacatttgccattgtagcagag
cctacctgcaatctcaaaatgggcgatgtcatcaagattggcaggcgcggttctatcaat
ggagagctgctcatcaagggcaagcaggggcatgtggcctatccagagaaatgtaaaaat
cccacagagattttgggcgcgcgcttgggcaggcttgctggggtggatctagatagtggg
gatgagagttttgcgccttccaagctcgtgatcacagatattcgtgggggcatagaggca
gtcaatgtcacgccaaattcgctaaaaatcctctttaatgtgcgcaacaataccaagacc
accaagcaagatattcaaaaatacataagcagcgtgctagaaggagtggagcatgagttg
accctcaagcagagctctcatccttttttgagtcccaaagagggctacatcgcacaaaag
atgcaagattgcatccaagagatcctaaaaattagcccagaattgagcaccagcgggggc
acgagcgatgcgagattctttgcaaaatatggtatagaagtggtagaatttggcgtcaaa
aatgataggatccatggcatcgatgaatgcgtggaaatcgccgatctggaggcgctttgt
gcgatttttgctaggcttgtcacaaaatttgcacaagacaaaattttagaaaaaaattta
attttacaaaaggagtaa

DBGET integrated database retrieval system