KEGG   Helicobacter mustelae: HMU09030Help
Entry
HMU09030          CDS       T01191                                 

Gene name
dut
Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase (EC:3.6.1.23)
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
hms  Helicobacter mustelae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMU09030 (dut)
Enzymes [BR:hms01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     HMU09030 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043696..1044124)
Genome map
AA seq 142 aa AA seqDB search
MQVKIKKIHPDAKIPLYQTQGAAGFDLQSIEEVVIPAHSHGLVKTGLCIQVPEGYELQVR
PRSGLAFKSGITVLNSPGTIDSDYRGEIMVILYNSTKEDFFIAKGDRIAQGVISQYAKVE
FDAVEDLDPSPRGEKGLGSTGI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaagattaaaaaaatccatccagatgcaaaaatccccctctatcaaactcaa
ggagctgcgggctttgatttgcagagcattgaggaagtggtgattccagcccacagtcat
ggattggttaagacagggctatgtatccaggttcctgaaggctatgagttgcaggtgcgt
cctagaagcggattggcattcaaatctggcatcactgtgctcaattccccaggaaccatt
gatagtgattatcgcggtgaaattatggtgattttgtataatagcaccaaagaagatttt
ttcattgccaagggagatcgtattgctcagggcgtgatttcccaatatgcaaaggtggaa
tttgatgcggtggaggatttggatcctagcccaaggggtgaaaaaggattaggtagcact
ggaatataa

DBGET integrated database retrieval system