KEGG   Helicobacter mustelae: HMU09030Help
Entry
HMU09030          CDS       T01191                                 

Gene name
dut
Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase (EC:3.6.1.23)
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
hms  Helicobacter mustelae
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hms00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043696..1044124)
Genome map
AA seq 142 aa AA seqDB search
MQVKIKKIHPDAKIPLYQTQGAAGFDLQSIEEVVIPAHSHGLVKTGLCIQVPEGYELQVR
PRSGLAFKSGITVLNSPGTIDSDYRGEIMVILYNSTKEDFFIAKGDRIAQGVISQYAKVE
FDAVEDLDPSPRGEKGLGSTGI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaagattaaaaaaatccatccagatgcaaaaatccccctctatcaaactcaa
ggagctgcgggctttgatttgcagagcattgaggaagtggtgattccagcccacagtcat
ggattggttaagacagggctatgtatccaggttcctgaaggctatgagttgcaggtgcgt
cctagaagcggattggcattcaaatctggcatcactgtgctcaattccccaggaaccatt
gatagtgattatcgcggtgaaattatggtgattttgtataatagcaccaaagaagatttt
ttcattgccaagggagatcgtattgctcagggcgtgatttcccaatatgcaaaggtggaa
tttgatgcggtggaggatttggatcctagcccaaggggtgaaaaaggattaggtagcact
ggaatataa

DBGET integrated database retrieval system