KEGG   Helicobacter mustelae: HMU10780Help
Entry
HMU10780          CDS       T01191                                 

Gene name
atoB2
Definition
(GenBank) acetyl-CoA acetyltransferase 2
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hms  Helicobacter mustelae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMU10780 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    HMU10780 (atoB2)
   00640 Propanoate metabolism
    HMU10780 (atoB2)
   00650 Butanoate metabolism
    HMU10780 (atoB2)
  Lipid metabolism
   00071 Fatty acid degradation
    HMU10780 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    HMU10780 (atoB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMU10780 (atoB2)
   00310 Lysine degradation
    HMU10780 (atoB2)
   00380 Tryptophan metabolism
    HMU10780 (atoB2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMU10780 (atoB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMU10780 (atoB2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HMU10780 (atoB2)
Enzymes [BR:hms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMU10780 (atoB2)
Exosome [BR:hms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMU10780 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1198854..1200113
Genome map
AA seq 419 aa AA seqDB search
MRLSSEAFCKILQLCLYNVTNINKGISMEEVVIVAAKRSAIGSFLGSLKNLKATDLAKQL
AKAILQSIKLDPHLIDEVILGQVLQSNQGQNPARQVLLEIGGLEKSAFMVNKVCGSGLKA
VWLGYQAIALGDREVVLAGGVENMSLAPFLLENARSGYKLGNQTLIDAIIKDGLWCANTD
VHMGITAENLAKKYNISRTEQDEFALSSQQKATKAIQEGRFQEEIAPISIQEKKGEFIFL
QDEFVKQDSTIEALAKLKPAFLKEGSVSAGNASGINDGAAMLVLMSKTKAKELNLEILAS
LKAFASAGVEPSIMGIGAAVAAKKVMEKTGLQIKDFDLIEANEAFAAQSIACLKELGAKE
EKVNVNGGAIALGHPIGASGARILVTLIHALRNQKKNLGLATLCIGGGQGISAVIEINE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ttgagactttcttctgaagcgttttgtaaaattttacaattatgcctctataatgtcaca
aatatcaacaaaggaatctctatggaagaagttgtgattgttgcggccaaaaggagcgcg
attggttcttttctaggtagtctaaaaaatcttaaagccacggatttagcaaagcagctc
gccaaagctatattgcaatccataaaactcgatccccatctcattgatgaggtgattttg
gggcaggttttacagagcaatcaaggacaaaatcccgcaagacaggtattgcttgaaata
ggaggactggaaaaatctgcttttatggtaaataaagtatgtggctctggcttgaaggcg
gtttggctgggctatcaagccatagccctaggggatagagaggtggtcttggcagggggt
gtagaaaacatgtcccttgctccctttctgcttgaaaatgcacgcagcggctataaattg
ggaaatcaaaccctcattgatgccatcattaaagatgggctatggtgtgccaatacagat
gtgcacatgggaatcacagcagaaaatctcgccaaaaaatacaatatctctcgaacagaa
caagatgaatttgcactatcctcacaacaaaaagccacaaaagccatccaggaggggaga
tttcaagaagagatcgctcctataagcatccaagaaaaaaaaggagaatttatcttcttg
caagatgaatttgtcaaacaagactccaccatcgaagcacttgcaaaattaaaacccgca
tttctcaaagaaggaagtgttagcgctgggaatgcttctggcatcaatgatggtgctgca
atgcttgttttgatgagcaagacaaaagccaaggagttgaatttagagattttagcaagt
ttgaaagcttttgcaagcgcgggagtggagccctctatcatggggattggtgcggctgtg
gcagcaaaaaaagtcatggaaaaaaccggattgcaaataaaagattttgatctcattgag
gcaaatgaggcatttgcagcgcaaagcattgcatgcctcaaagaacttggcgccaaagaa
gaaaaggtaaatgtcaatggtggtgcgatagcccttggacatcccattggcgcgagtgga
gcgaggatcctcgtgactctaatccatgccctgagaaatcaaaaaaagaatctagggctt
gccactctgtgtatcggtggcggacaaggcatcagtgctgtgattgaaatcaacgaataa

DBGET integrated database retrieval system