KEGG   Helicobacter mustelae: HMU10830Help
Entry
HMU10830          CDS       T01191                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hms  Helicobacter mustelae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hms00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hms00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202862..1203629
Genome map
AA seq 255 aa AA seqDB search
MEHKVAIVTGSASGIGLCIAEKFLQSHIKVVFSDYNEEALEKTIKEHQDFECIGIPCDMA
KEEDVKNLIQKTQEQYGRIDILVNNAGLQYVASIEDFPTQMFEKMIQVMLVGSFMSAKYA
IPHMKQQNFGRVINMASINGLIGFAGKAAYNSAKHGIIGLTKVIALECAKSNITCNAICP
GYVDTPLVRGQMQDLARQRGVSIESVLNEVLYPLIPQKRLIDIQDIASLALFLCNDSAKH
ITGQSLVIDGGYTAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaagtagcgattgttacaggaagtgccagcggcatagggctttgtatcgca
gaaaaattcttgcaatctcatatcaaagtggtgttttctgactacaatgaggaagcatta
gaaaaaaccataaaagagcatcaagattttgagtgcataggcattccttgcgatatggca
aaagaagaggatgtcaaaaatctcatccaaaagacacaagagcagtatggacgcattgat
attcttgtcaataatgcgggattacagtatgtggccagtatcgaagatttccccacccag
atgtttgaaaagatgattcaagtgatgcttgtgggttcttttatgagtgccaaatatgcc
ataccccatatgaaacaacaaaactttggcagggtgatcaatatggcttccatcaatggg
cttataggctttgctggcaaagccgcctataatagcgctaaacacggaatcatagggctc
actaaggtgattgccctagaatgcgccaaatccaacatcacctgcaatgccatctgccct
ggttatgttgatacaccgcttgtaagggggcagatgcaggatttggccagacaaagaggg
gtcagcatagaatctgtactcaatgaagtactctatccactcatcccacaaaaaagactc
atagacatccaagacatcgcttctttggcgcttttcttgtgtaatgatagtgccaaacat
attacaggacaatcgcttgtgattgatgggggctatactgctcaataa

DBGET integrated database retrieval system