KEGG   Helicobacter mustelae: HMU12350Help
Entry
HMU12350          CDS       T01191                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
hms  Helicobacter mustelae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hms03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1356315..1356896
Genome map
AA seq 193 aa AA seqDB search
MKSYKNNLRHFNALLESLEQIPAIGKKSALKIAYAISVENKFLGLKIAHCIENAISHARN
CSLCNALSENELCDICSDENRDSSQLCMVLHSKDIFTIEETGDYKGLYFVIQDPKALDFS
RLQKQILDHQTREIIFAFSPTLANDAIMLYIEDKLQHLDLSFSKIAQGVPTGIGLDNVDQ
LSLSKAILWRTKI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttacaaaaataacctaaggcatttcaatgctctattagaatccctagagcag
atccctgccatcgggaaaaaaagcgcattaaaaatcgcctatgccatcagcgtggaaaat
aaatttttgggactaaaaatcgcacactgcatcgaaaatgccatctctcatgcacgcaac
tgcagtctatgcaatgcgctgagtgaaaatgaattatgcgacatctgcagtgatgagaat
cgcgattcctcacaattatgcatggtcttgcattctaaagatatttttaccatcgaagaa
acaggggattataagggattgtattttgtcatccaggatccaaaggcactagatttttct
agattgcaaaaacaaatcctagaccaccaaacaagagagattatctttgccttcagtcct
acgctggcaaatgatgccatcatgctgtatatcgaggataagctccagcatttggatctg
agttttagcaaaattgcccaaggtgtgccaacgggcatagggctagataatgtcgatcaa
ctctcgctttccaaggccatcctctggcgcacaaaaatctag

DBGET integrated database retrieval system