KEGG   Helicobacter mustelae: HMU12400Help
Entry
HMU12400          CDS       T01191                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hms  Helicobacter mustelae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hms00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1360402..1360947
Genome map
AA seq 181 aa AA seqDB search
MINFEKFFLKIGEDPNREGLRDTPKRIKKLYESLFDGYHKDIDQALGSVFNEEHFDSMIT
LKDMEFYSMCEHHLLPFFGKIHIGYIPNEKLAGIGGLARLVDIFAHRLQIQERFTNQIAD
ILMQKLSPKGVMVTCEATHLCMRMQGMQKQHANIHTSAVRGIFKTDSRTRSEFIAFVAAK
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgattaattttgaaaaattcttcttgaaaatcggagaggatcccaaccgagagggctta
agagatactccaaaacgcatcaagaagctttatgaaagcctctttgatggctatcataaa
gacatagatcaagcactgggcagcgtgtttaatgaagagcattttgatagcatgattacg
ctcaaagatatggaattttattccatgtgcgagcatcatctcctgcctttttttggcaag
atccacatcggttacattcccaatgagaaactcgctggcattggtgggctagcaaggctg
gtggatatttttgcacatcgcttgcaaatccaagaacgcttcaccaaccaaatcgctgat
atattgatgcaaaagctaagtcccaagggcgtaatggtaacttgcgaggcgacacatctt
tgcatgcgcatgcagggcatgcaaaaacaacatgccaacatccacaccagcgcagtcaga
gggattttcaaaacagatagccgaacgcgctcagaattcatcgcctttgtggcagcaaaa
tcttaa

DBGET integrated database retrieval system