KEGG   Helicobacter mustelae: HMU12890Help
Entry
HMU12890          CDS       T01191                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMU12890 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMU12890 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMU12890 (thrC)
Enzymes [BR:hms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMU12890 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402930..1404372
Genome map
AA seq 480 aa AA seqDB search
MLSFVGTRDQQTTTTFKQALLHQDSPHGGLWVPQELPKIDFEKFTSLSYTALCKSLFEAL
DLGVEDSLLNEALKRYESFDDPSNPAPLHPISPDLSIQELYHGRTRAFKDMALAPFGALF
SALCKQEKQQYLILAATSGDTGPAALDSFANLLYTKVVCLYPKGGTSDVQELQMITQNAK
NLFVFGIEGNFDDAQSILKSLIQKKDFHKKLKDSGHALSVANSVNFGRIIFQILYHIWGY
LHYLKERNLPYGVMVKTIIPSGNFGNALGAFYAKKMGLPIEKILIATNKNNILHDFITTG
SYDISKRQLLHTYSPAMDILKSSNVERVLFALFGANKTRTLMQELEEKKSYTLSKEEHLR
LQKDFESLDCSDTQCLEILKKYYFQNILIDPHTANAIHAYEKLKGAHNIVCSTAEWSKFA
PIITKATTGKMLCDKDAIAHIEQTQSLTPSPHIQELFEKKILHQKVLHISSVEDAILELL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgctaagttttgtaggcaccagagatcagcaaacaaccaccactttcaagcaagcttta
ttacatcaagattctccccatggtggtctatgggtaccacaagaactcccaaaaatcgat
tttgaaaaattcacctccctctcctacaccgcattatgcaaatccctatttgaagcgctg
gatttgggggtagaggattctttgctaaatgaggcactaaagcgctatgagagctttgat
gatcctagcaatcccgctccattgcatcccatctcccctgatctctccatccaggagctc
tatcatggcaggactcgcgcatttaaagacatggcattagcgccatttggtgcacttttt
agcgctctttgcaaacaagaaaaacaacaatacctcatccttgctgccacaagcggagac
acaggcccagctgcgctagatagctttgcaaatctcctctacactaaagtcgtctgcctc
tatcccaagggaggcacgagcgatgtgcaggaattgcaaatgattacacaaaatgccaaa
aatctttttgtctttgggattgaggggaattttgatgatgctcaaagcatcctaaaatcc
ctgattcaaaaaaaagatttccacaaaaaactcaaagatagcggccatgcactatcagta
gcaaattctgtgaattttggaagaattatttttcagattctctatcatatctgggggtat
ttgcattatctcaaagagcgcaatctcccctatggagtgatggttaagacaattattccc
agcgggaattttggcaatgcactgggggctttttatgccaaaaaaatggggcttcccata
gaaaaaatcctcattgccaccaataaaaataatatcttgcatgacttcatcactacaggc
agctatgatatttccaagcgccaacttttgcacacctattctcccgccatggacattctc
aaaagctctaatgtagagcgcgtcttgtttgctttatttggcgcaaataagacaaggaca
ctcatgcaagagctagaagaaaaaaaatcctacacccttagcaaagaagagcatttgaga
ttgcaaaaagattttgagtccctagattgcagcgatacgcagtgcctagaaattttgaaa
aaatattacttccaaaacatcctgattgacccccacaccgccaatgccatccatgcctat
gaaaaactcaaaggggcgcataacatcgtctgctccactgctgaatggagtaaatttgca
cccattattacaaaggctactacagggaaaatgctttgtgacaaagatgcaatagctcat
atagaacaaacacaaagcctcaccccttctccgcatatccaagaattatttgaaaaaaag
attttgcaccaaaaagtgttgcacatctcctctgtagaagatgccatcttggaattgctc
taa

DBGET integrated database retrieval system