KEGG   Helicobacter mustelae: HMU12890Help
Entry
HMU12890          CDS       T01191                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hms  Helicobacter mustelae
Pathway
hms00260  Glycine, serine and threonine metabolism
hms00750  Vitamin B6 metabolism
hms01100  Metabolic pathways
hms01110  Biosynthesis of secondary metabolites
hms01120  Microbial metabolism in diverse environments
hms01230  Biosynthesis of amino acids
Module
hms_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMU12890 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMU12890 (thrC)
Enzymes [BR:hms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMU12890 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N DUF4252
Motif
Other DBs
NCBI-ProteinID: CBG40543
UniProt: D3UJ68
Position
1402930..1404372
Genome map
AA seq 480 aa AA seqDB search
MLSFVGTRDQQTTTTFKQALLHQDSPHGGLWVPQELPKIDFEKFTSLSYTALCKSLFEAL
DLGVEDSLLNEALKRYESFDDPSNPAPLHPISPDLSIQELYHGRTRAFKDMALAPFGALF
SALCKQEKQQYLILAATSGDTGPAALDSFANLLYTKVVCLYPKGGTSDVQELQMITQNAK
NLFVFGIEGNFDDAQSILKSLIQKKDFHKKLKDSGHALSVANSVNFGRIIFQILYHIWGY
LHYLKERNLPYGVMVKTIIPSGNFGNALGAFYAKKMGLPIEKILIATNKNNILHDFITTG
SYDISKRQLLHTYSPAMDILKSSNVERVLFALFGANKTRTLMQELEEKKSYTLSKEEHLR
LQKDFESLDCSDTQCLEILKKYYFQNILIDPHTANAIHAYEKLKGAHNIVCSTAEWSKFA
PIITKATTGKMLCDKDAIAHIEQTQSLTPSPHIQELFEKKILHQKVLHISSVEDAILELL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgctaagttttgtaggcaccagagatcagcaaacaaccaccactttcaagcaagcttta
ttacatcaagattctccccatggtggtctatgggtaccacaagaactcccaaaaatcgat
tttgaaaaattcacctccctctcctacaccgcattatgcaaatccctatttgaagcgctg
gatttgggggtagaggattctttgctaaatgaggcactaaagcgctatgagagctttgat
gatcctagcaatcccgctccattgcatcccatctcccctgatctctccatccaggagctc
tatcatggcaggactcgcgcatttaaagacatggcattagcgccatttggtgcacttttt
agcgctctttgcaaacaagaaaaacaacaatacctcatccttgctgccacaagcggagac
acaggcccagctgcgctagatagctttgcaaatctcctctacactaaagtcgtctgcctc
tatcccaagggaggcacgagcgatgtgcaggaattgcaaatgattacacaaaatgccaaa
aatctttttgtctttgggattgaggggaattttgatgatgctcaaagcatcctaaaatcc
ctgattcaaaaaaaagatttccacaaaaaactcaaagatagcggccatgcactatcagta
gcaaattctgtgaattttggaagaattatttttcagattctctatcatatctgggggtat
ttgcattatctcaaagagcgcaatctcccctatggagtgatggttaagacaattattccc
agcgggaattttggcaatgcactgggggctttttatgccaaaaaaatggggcttcccata
gaaaaaatcctcattgccaccaataaaaataatatcttgcatgacttcatcactacaggc
agctatgatatttccaagcgccaacttttgcacacctattctcccgccatggacattctc
aaaagctctaatgtagagcgcgtcttgtttgctttatttggcgcaaataagacaaggaca
ctcatgcaagagctagaagaaaaaaaatcctacacccttagcaaagaagagcatttgaga
ttgcaaaaagattttgagtccctagattgcagcgatacgcagtgcctagaaattttgaaa
aaatattacttccaaaacatcctgattgacccccacaccgccaatgccatccatgcctat
gaaaaactcaaaggggcgcataacatcgtctgctccactgctgaatggagtaaatttgca
cccattattacaaaggctactacagggaaaatgctttgtgacaaagatgcaatagctcat
atagaacaaacacaaagcctcaccccttctccgcatatccaagaattatttgaaaaaaag
attttgcaccaaaaagtgttgcacatctcctctgtagaagatgccatcttggaattgctc
taa

DBGET integrated database retrieval system