KEGG   Helicobacter mustelae: HMU13360Help
Entry
HMU13360          CDS       T01191                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hms  Helicobacter mustelae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMU13360 (tpiA)
   01230 Biosynthesis of amino acids
    HMU13360 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMU13360 (tpiA)
   00051 Fructose and mannose metabolism
    HMU13360 (tpiA)
   00562 Inositol phosphate metabolism
    HMU13360 (tpiA)
Enzymes [BR:hms01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMU13360 (tpiA)
Exosome [BR:hms04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMU13360 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMU13360 (tpiA)
  Exosomal proteins of melanoma cells
   HMU13360 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451148..1451855
Genome map
AA seq 235 aa AA seqDB search
MGKIIAGNFKSNLTKSKIAEYYKKLNASLDAKDSVYVFAPFFGLEGVEEQRFFIGAQNAY
PAKNGAFTGEITLEALQDLKIHHLLIGHSERRNILQESQEFCAQKFEFFRAQGFHIFYCI
GESLEVRQAGEDAIRHFLKSQFEGIDVNYEGLTIAYEPIWAIGTGVSADARQIQSTHEFI
KKLCPRPLLYGGSVRAENITQILQIPNVDGVLIGGASLDVGIFLEMIKSARNIKG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagattattgctgggaattttaaaagcaatttgacaaaaagcaaaattgcagag
tattacaagaagctcaatgccagcctagatgcaaaagattctgtgtatgtctttgcacca
tttttcggattagaaggagtggaggagcagaggttttttatcggggcacagaatgcctat
cctgcaaaaaatggggcatttactggtgaaatcaccctagaagccctgcaagatctaaaa
atccatcaccttctcatcggacatagcgaacgcaggaacatcctccaagaaagccaggag
ttttgcgcacaaaaatttgaattttttagggcacagggttttcatattttttattgcatc
ggagaaagcttagaggtgcgccaagcaggtgaggatgctattagacactttctaaaaagc
caatttgagggaattgatgtcaattatgaagggctcaccattgcttatgagcccatctgg
gccattggcacaggcgtaagcgctgatgctaggcaaatacagagcactcatgaatttatc
aaaaaactctgcccacgccccctgctctatggtggaagcgtgcgggctgaaaacatcact
caaatcctgcaaatcccaaatgtcgatggggtgctcattggcggagcttcgctggatgtg
ggcattttcttggaaatgataaaatcggctcgaaatatcaaaggatga

DBGET integrated database retrieval system