KEGG   Halomicrobium mukohataei: Hmuk_0523Help
Entry
Hmuk_0523         CDS       T00982                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hmu  Halomicrobium mukohataei
Brite
Enzymes [BR:hmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hmuk_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(494009..494746)
Genome map
AA seq 245 aa AA seqDB search
MEQAVLREDMVDSLTHESKGCLQTPRLADAMRTVSREAFVEDDRAAYSDRSFERFGTRVL
APSTAARLLEALAPEADDDVLIVGVGVGYTAALVAEIVGPERVHAIDITRRLVYDARSNL
ATAGYEAVLVDRRDGAEGLPEYAPYDKILLEAAAVEPPRALREQLADDGRLVMPLGAAEQ
TLTVVAADGSQRRLGGVAFQPMLVEGEQADTVERNRTHREDRERAQQAAQSRAGWEQEWI
DWDDY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggcggtgctgcgggaggacatggtcgacagcctgacccacgagagcaagggc
tgtctgcagacaccgcgtctcgcggacgcgatgcgaacggtctcgcgggaagcgttcgtc
gaggacgaccgagcggcctactccgaccggtcgttcgagcggttcgggacccgcgtcctc
gcaccgagcaccgcggcacgactcctcgaagcgctggcccccgaggcggacgacgacgtg
ctgatcgtcggcgtcggcgtcggctacacggccgcgctcgtcgccgagatcgtcggcccc
gagcgtgtccacgccatcgacatcacgcgccggctggtgtacgacgcccgttcgaacctc
gcgacggccggctacgaggcggtcctcgtggaccgtcgcgacggggccgagggactcccc
gagtacgcgccctacgacaagatcctgctggaggcggcggccgtcgaaccgccgcgagcg
ctccgggagcaactggccgacgacggtcgcctggtcatgccactcggtgcggccgagcag
acgctgacggtcgtcgcggccgacggcagtcagcgccgcctcggtggcgtcgccttccag
ccgatgctcgtcgagggcgagcaggcagacaccgtcgaacgcaaccgcacccaccgcgag
gaccgcgaacgcgcccagcaggccgcccagtcgcgggcgggctgggagcaagagtggatc
gactgggacgactactag

DBGET integrated database retrieval system