KEGG   Halomicrobium mukohataei: Hmuk_0583Help
Entry
Hmuk_0583         CDS       T00982                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hmuk_0583
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hmuk_0583
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hmuk_0583
Enzymes [BR:hmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hmuk_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(547271..548425)
Genome map
AA seq 384 aa AA seqDB search
MSDGDFAGYGGRHVPDPLVAPLEQLATTYDDIRETTAFQTELRDLLESFAGRPTPLFHAE
TLSDSWGAEIFLKREDLLHGGAHKINNTLGQALLAKQAGKERLIAETGAGQHGTATAMAG
ALLDLDTEIYMGKQDVERQRMNVFRMRLMGATVNEVTRGEEGLAEAVDVALEDFAHNVDD
THYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFQDRTGELPDAAVACVGGGSNAMGLFHA
FRDDDVAFYGGEGGGEGADSERHAAPLAAGTEGVLHGMKTRVIDDDVSVHSVSAGLDYPG
VGPEHAMFRELGRAQYRGITDEEALGAFRELSESEGIIPALETSHGLALAKQLAEDGDHE
TILVNLSGRGDKDMAQAAEQFDLS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcgacttcgcggggtacggcggccgccacgtccccgatccgctggtagca
ccgctcgaacagctcgcgacgacctacgacgacattcgagagacgacggcgttccagacg
gagctccgggacctgctcgaatcgttcgccgggcgaccgacacccctgtttcacgcggag
acgctcagcgacagctggggagcggagatcttcctcaagcgcgaggacctgctccacggc
ggggctcacaagatcaacaacacgctcgggcaggcgctgcttgccaagcaggccggcaag
gagcgactgatcgccgagaccggcgcgggccagcacggcacggcgacggcgatggccggt
gcgctgctggacctcgacacggagatctacatgggcaagcaagacgtcgagcgccagcgg
atgaacgtcttcaggatgcgcctgatgggtgcgacggtcaacgaagtgacccggggcgag
gaggggctggccgaggccgtcgacgtcgctctggaggacttcgcgcacaacgtcgacgac
acccactacctcgtgggcagcgtcgtcggccccgacccgttcccgcggatggtccgggac
ttccagagcgtcatcggcgaggaggcccgcgagcagttccaggaccgcacgggcgagttg
cccgacgccgcggtcgcctgcgtcggcggaggctcgaacgcgatgggactcttccacgcc
ttccgggacgacgacgtggccttctacggcggcgagggcggcggtgagggtgccgactcg
gagcgccacgctgcgccgctcgcggcgggcaccgagggggtcctccacgggatgaagacg
cgggtcatcgacgacgacgtgtctgtccactccgtctcggcgggcctggactaccccggc
gtcggcccggaacacgccatgttccgcgaactcggtcgtgcccagtaccgcgggatcacc
gacgaggaagccctcggggcgttccgcgaactctccgagtccgaggggatcatccccgca
ctggagacgagccacggcctcgcgctcgcgaagcaactggccgaggacggcgaccacgag
acgatcctcgtgaacctctcgggacggggcgacaaggacatggcacaggccgcagagcag
ttcgatctctcctga

DBGET integrated database retrieval system