KEGG   Halomicrobium mukohataei: Hmuk_0592Help
Entry
Hmuk_0592         CDS       T00982                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hmu  Halomicrobium mukohataei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hmuk_0592
Enzymes [BR:hmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Hmuk_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554833..555459
Genome map
AA seq 208 aa AA seqDB search
MTDETTMEDAAEATNAPATVPDGEGIDWEKAQEGTRLLLESIGEDPTADGLEATWQRRVP
ALFETFSEANREAEKPTMRTFEADQEGLVVKTGIPVYSLCEHHLLPYHGTAHVAYRPDER
VVGLSKLVRYVRWQGRKPSMQERLTRDIADGLAAELDAAAVLVEIEATHMCEAMRGVETA
TTTTTRSVVGSPTTTERERFTDAVKKHE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagacaacgatggaggacgcggccgaggcgacgaacgccccggccacagtc
cccgacggcgagggtatcgactgggagaaagcacaggaaggcacccgcctcctgctggaa
tcgataggcgaggacccgaccgcggacggcctcgaagccacctggcagcgtcgggtgccc
gcactgttcgagacgttcagcgaggccaaccgcgaggccgagaagccgacgatgcggacc
ttcgaagccgatcaggagggactggtcgtcaagaccggtatcccggtgtatagcctctgt
gagcaccacctgctgccctaccacgggacggcacacgtcgcctaccgaccggacgagcgg
gtcgtcggcctctcgaagctggtccggtacgtccgctggcagggccgcaagccctcgatg
caggaacgcctgacgcgcgacatcgccgacggactggcggcagaactggacgcggcggcc
gtgctggtcgagatcgaggccacccacatgtgcgaggccatgcgcggcgtcgagaccgcg
accacgacgacgacccgctcggtcgtcggatcgccgacgacgaccgaacgcgaacgcttc
accgacgccgtcaagaaacatgagtga

DBGET integrated database retrieval system