KEGG   Halomicrobium mukohataei: Hmuk_0659Help
Entry
Hmuk_0659         CDS       T00982                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00010  Glycolysis / Gluconeogenesis
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
hmu01200  Carbon metabolism
hmu01230  Biosynthesis of amino acids
Module
hmu_M00002  Glycolysis, core module involving three-carbon compounds
hmu_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_0659
Enzymes [BR:hmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Hmuk_0659
Membrane trafficking [BR:hmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Hmuk_0659
Exosome [BR:hmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Hmuk_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACV46791
JGI: Hmuk_0659
UniProt: C7NZA5
Position
613491..614498
Genome map
AA seq 335 aa AA seqDB search
MSEETVRVGVNGFGRIGRNVFRASLDNDAIEIVGINDVMEDEEMEYLAKYDSVMGRLDGA
SLDDGTLTVEGTDFEAGVFHETDPTQLPWEELDVDITFESTGIFRSHEDASQHLDAGADK
VVISAPPKGDTPVKQLVYGVNHDEYDGEDVVSNASCTTNSITPVAKVLQDEFGIESGQLT
TVHAYTGTQNLVDGPNSKPRRRRAAAENIIPTTTGAAQAATEVLPELEGKLDGMAMRVPV
PDGSITEFVCTLETDATESDINAAFEAAADGELEGVLGVSDDPIVSRDVLGQPYSTMVDL
ENTNVVGDLVKVLTWYDNEFGFANRMLDLAAFVAE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaaccgttcgcgtcggagtcaacggcttcggccgcatcggtcgcaacgtg
ttccgcgcatcgctggacaacgacgccatcgagatcgtcggcatcaacgacgtgatggaa
gacgaggagatggagtatctcgccaagtacgactccgtcatgggacgactcgacggtgcc
agcctcgacgacggaactctgaccgtcgaggggaccgacttcgaggcgggcgtcttccac
gaaaccgatccaacccagctcccctgggaggaactggacgtcgacatcaccttcgagtcg
accggcatcttccgcagccacgaagacgcgagccaacacctcgacgcgggtgccgacaaa
gtcgtcatctctgcaccgccgaagggcgacacgccggtcaaacaactcgtctacggcgtc
aaccacgacgagtacgacggcgaagacgtcgtctcgaacgcctcctgtacgacaaactcc
atcaccccggtcgcgaaggtactgcaagacgaattcggaatcgagtcgggacagttgacg
acggtccacgcctacacgggcacccagaacctcgtcgacggccccaacagcaagccccgc
cgtcgccgcgctgcggccgagaacatcatcccgacgacgacgggcgctgcccaggccgcg
accgaagtcctccccgaactcgaagggaaactcgacgggatggcaatgcgcgtcccagtc
cccgacggttcgatcaccgagttcgtctgtacactcgaaacggacgccaccgagagcgac
atcaacgccgccttcgaggccgccgccgacggagaactcgaaggcgtactgggcgtcagt
gacgacccgatcgtctctcgggacgtgctgggccagccctactcgacgatggtcgacctc
gagaacacgaacgtcgtcggcgacctcgtcaaagtgctgacctggtacgacaacgagttc
ggcttcgccaaccgcatgctcgacctcgcagcgttcgtcgccgagtaa

DBGET integrated database retrieval system