KEGG   Halomicrobium mukohataei: Hmuk_0782Help
Entry
Hmuk_0782         CDS       T00982                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hmuk_0782
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hmuk_0782
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hmuk_0782
Enzymes [BR:hmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hmuk_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
751743..753122
Genome map
AA seq 459 aa AA seqDB search
MADLQLTDETPGIADDGVWLTCIECGETFAPFAAVRYTCDECDGLLEVRYEDLPTFDDFD
GEGVWRYSDALPFEEGVTLPEGHTPLHRVPRLEAEVDVDALRIKHEGMNPTGSFKDRGMT
VGVRVAQAVGVDRLACASTGNTSAALAAYGARADLETLVLLPAGKVAAGKVAQASLHGAR
ILEVDGNFDSCLDIVQELAGRGEAYLLNSLNPFRLEGQKTIGLEIMEQFAADYDDYPDRI
VLPVGNAGNTAALYKCFRELVAAGAIDESDVPKITGVQAEGSAPMVEAIEEGNDEVRRWD
EVETIATAIRIGNPVNAPKALPGIRETGGTAVAVSDEEITDAQRSLAGEGVGVEPASAAS
VAGLRKLRAQGEIGSDERVVCLTTGHLLKDPDAAAEAGADPEPVPNDTDAILEHIDEGSS
VVDAVGRAASKAVSGSKVPLLVGAGLGVAYLYRRLRSSK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctacagttgaccgacgagacgccggggatcgccgacgacggcgtctggctg
acgtgcatcgagtgtggggagacgttcgcgccgttcgcagcggtcaggtacacctgcgac
gagtgtgacggactgctggaagttcgctacgaggacctgccgacgttcgacgacttcgac
ggcgaaggcgtctggcgctacagcgacgcactgcccttcgaggagggcgtgacgctgccg
gagggacacacgccgctgcaccgggtgccacgcctggaagcggaagtcgatgtcgacgcc
ctgcggatcaaacacgagggaatgaatcccacgggatcgttcaaggaccgcgggatgacc
gtcggcgtccgcgtggcccaggccgtcggcgtcgaccgactcgcctgtgcctcgacgggc
aacacctccgcggcgctcgcggcctacggcgctcgcgcggacctggagacgctcgttctc
ctgccggccggcaaggtcgccgccgggaaggtcgcacaggcctcgctccacggcgcacgg
atcctcgaagtcgacggcaacttcgacagctgtctggacatcgttcaggagctcgcgggc
cggggcgaggcgtacctcctgaactcgctgaaccccttccggctggagggccagaagacc
atcggcctggagatcatggagcagttcgccgccgactacgacgactaccccgaccggatc
gtgctgccggtgggcaacgccggcaacaccgcagcgctgtacaagtgcttccgcgaactc
gtcgcggccggcgcgatcgacgagtcggacgtgccgaagatcaccggcgtccaggccgaa
gggtccgcgccgatggtcgaggctatcgaggagggcaacgacgaagtccggcgctgggac
gaggtcgagaccatcgcgaccgccatccgcatcggcaatcccgtcaacgcgcccaaggcg
ctgccgggcatccgcgagaccggcggcaccgcggtcgcggtcagcgacgaggagatcacc
gacgcccagcgctcgctggccggcgagggcgtcggcgtcgagccggcctccgcggccagc
gtcgccggcctccggaagctccgagcccagggcgagatcggcagcgacgagcgggtcgtc
tgcctgacgaccggccacctgctgaaagaccccgatgccgccgccgaggcaggggccgat
ccagagccggtgcccaacgacaccgacgccatcctagagcacatcgacgaggggtcgtca
gtcgtcgacgcggtcggtcgagcggcgtcgaaggccgtctcgggctcgaaagtaccgctg
ctggtcggggccggtctcggcgtcgcgtacctctatcgaaggcttcgttcaagtaagtaa

DBGET integrated database retrieval system