KEGG   Halomicrobium mukohataei: Hmuk_0852Help
Entry
Hmuk_0852         CDS       T00982                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00010  Glycolysis / Gluconeogenesis
hmu00030  Pentose phosphate pathway
hmu00051  Fructose and mannose metabolism
hmu00052  Galactose metabolism
hmu00230  Purine metabolism
hmu00500  Starch and sucrose metabolism
hmu00520  Amino sugar and nucleotide sugar metabolism
hmu00521  Streptomycin biosynthesis
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_0852
   00030 Pentose phosphate pathway
    Hmuk_0852
   00051 Fructose and mannose metabolism
    Hmuk_0852
   00052 Galactose metabolism
    Hmuk_0852
   00500 Starch and sucrose metabolism
    Hmuk_0852
   00520 Amino sugar and nucleotide sugar metabolism
    Hmuk_0852
  Nucleotide metabolism
   00230 Purine metabolism
    Hmuk_0852
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hmuk_0852
Enzymes [BR:hmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hmuk_0852
    5.4.2.8  phosphomannomutase
     Hmuk_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_IV PGM_PMM_III
Motif
Other DBs
NCBI-ProteinID: ACV46983
JGI: Hmuk_0852
UniProt: C7P0K1
Position
824805..826169
Genome map
AA seq 454 aa AA seqDB search
MHVFGSSGVRGVANEEVTPAYVLQIAQATGSVWDDARIALARDTRTSGEMLADAAASGLA
STGHSVDLLGEAPTPTLQAYCARHGVPGMMITASHNPPAYNGVKLIGADGVELDRTVLDD
IEDRLEATEFDTVRWDGLGRTRAVDGAGDDYITEVLDTVDRTAIAAADLTVVVDPGHGAG
CHTSPTFLRELGCTVRTVNAQPDGHFPGRDPEPIDPHLADLREYVRTTDADLGIAHDGDA
DRAVFVDETGTTINGDAALAALVEATVEPGDTVVSAVNASQRLVDVVEAADAELTLTRIG
STYLITRIQQLRAAGETVSVAGEGNGGIIFPGYRIARDGAYTAGKFLELVAEEPASEIAA
RFDDYVNVRAAVEYEDETERAAMLDAVEAAATEAVADLDTTDGYRLNYGDGWVLARPSGT
EPVVRIYAEAHTQQRADELLSTFADPIDRVREDG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcttcgggtccagcggcgtcagaggtgtggcaaacgaggaggtgacaccggcg
tacgtcctacagatcgcacaggcgaccggctcggtgtgggacgacgcccgaatcgcgctg
gcacgagacacgcggaccagcggggagatgctcgcggacgccgcggccagcgggctggcc
agcaccggccactccgtcgacttgctcggcgaagcgccgacgccgacgttacaggcctac
tgtgcccgtcacggcgtccccggcatgatgatcaccgcctcgcacaacccgccagcgtac
aacggcgtcaagctgatcggcgcggacggggtcgaactcgacaggaccgtcctcgacgac
atcgaggatcgcctcgaagccacggagttcgacaccgtccggtgggacgggctgggccgg
acgagggcggtcgacggagccggcgacgactacattactgaagtcctcgacaccgtcgac
cggacggcgatcgcggcggcggatctgactgtggtcgtggacccgggccacggagccggc
tgtcacaccagcccgacgttcctgcgagagctcggctgtaccgtccgcaccgtcaatgcc
cagcccgacggccacttccccggtcgcgacccggaaccgatcgacccgcacctcgccgac
ctgcgagagtacgtccgcacgaccgacgccgacctcggcatcgcacacgacggcgacgcc
gaccgtgcggtgttcgtcgacgagaccgggacgacgatcaacggcgacgccgcactcgcg
gcgctcgtcgaggcgaccgtcgaacccggcgacaccgtcgtctcggcggtcaacgcctca
cagcgcctcgtcgacgtcgtcgaggccgccgacgccgagctgacgctgacccggatcggc
tcgacgtacctcatcacgcggatccagcagctccgggcggccggcgagaccgtcagcgtc
gcaggtgagggcaacggcggcatcatcttcccgggctaccggatcgcccgagacggggcc
tacaccgccgggaagttcctcgaactcgtcgccgaggaacccgcaagcgagatcgccgcc
cgcttcgacgactacgtcaacgtccgcgcggccgtcgagtacgaagacgagacagagcgc
gcggcgatgctcgacgccgtcgaagcggccgccaccgaggccgtcgcggacctcgatacg
accgatggctaccggctgaactacggcgacgggtgggtcctggcccgtccgtcggggacc
gagcccgtcgtccggatctacgccgaggcccacacccagcagcgggcagacgagctgcta
tcgaccttcgcggacccgatcgatcgagtccgcgaagacgggtga

DBGET integrated database retrieval system