KEGG   Halomicrobium mukohataei: Hmuk_0852Help
Entry
Hmuk_0852         CDS       T00982                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_0852
   00030 Pentose phosphate pathway
    Hmuk_0852
   00051 Fructose and mannose metabolism
    Hmuk_0852
   00052 Galactose metabolism
    Hmuk_0852
   00500 Starch and sucrose metabolism
    Hmuk_0852
   00520 Amino sugar and nucleotide sugar metabolism
    Hmuk_0852
  Nucleotide metabolism
   00230 Purine metabolism
    Hmuk_0852
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hmuk_0852
Enzymes [BR:hmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hmuk_0852
    5.4.2.8  phosphomannomutase
     Hmuk_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
824805..826169
Genome map
AA seq 454 aa AA seqDB search
MHVFGSSGVRGVANEEVTPAYVLQIAQATGSVWDDARIALARDTRTSGEMLADAAASGLA
STGHSVDLLGEAPTPTLQAYCARHGVPGMMITASHNPPAYNGVKLIGADGVELDRTVLDD
IEDRLEATEFDTVRWDGLGRTRAVDGAGDDYITEVLDTVDRTAIAAADLTVVVDPGHGAG
CHTSPTFLRELGCTVRTVNAQPDGHFPGRDPEPIDPHLADLREYVRTTDADLGIAHDGDA
DRAVFVDETGTTINGDAALAALVEATVEPGDTVVSAVNASQRLVDVVEAADAELTLTRIG
STYLITRIQQLRAAGETVSVAGEGNGGIIFPGYRIARDGAYTAGKFLELVAEEPASEIAA
RFDDYVNVRAAVEYEDETERAAMLDAVEAAATEAVADLDTTDGYRLNYGDGWVLARPSGT
EPVVRIYAEAHTQQRADELLSTFADPIDRVREDG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcttcgggtccagcggcgtcagaggtgtggcaaacgaggaggtgacaccggcg
tacgtcctacagatcgcacaggcgaccggctcggtgtgggacgacgcccgaatcgcgctg
gcacgagacacgcggaccagcggggagatgctcgcggacgccgcggccagcgggctggcc
agcaccggccactccgtcgacttgctcggcgaagcgccgacgccgacgttacaggcctac
tgtgcccgtcacggcgtccccggcatgatgatcaccgcctcgcacaacccgccagcgtac
aacggcgtcaagctgatcggcgcggacggggtcgaactcgacaggaccgtcctcgacgac
atcgaggatcgcctcgaagccacggagttcgacaccgtccggtgggacgggctgggccgg
acgagggcggtcgacggagccggcgacgactacattactgaagtcctcgacaccgtcgac
cggacggcgatcgcggcggcggatctgactgtggtcgtggacccgggccacggagccggc
tgtcacaccagcccgacgttcctgcgagagctcggctgtaccgtccgcaccgtcaatgcc
cagcccgacggccacttccccggtcgcgacccggaaccgatcgacccgcacctcgccgac
ctgcgagagtacgtccgcacgaccgacgccgacctcggcatcgcacacgacggcgacgcc
gaccgtgcggtgttcgtcgacgagaccgggacgacgatcaacggcgacgccgcactcgcg
gcgctcgtcgaggcgaccgtcgaacccggcgacaccgtcgtctcggcggtcaacgcctca
cagcgcctcgtcgacgtcgtcgaggccgccgacgccgagctgacgctgacccggatcggc
tcgacgtacctcatcacgcggatccagcagctccgggcggccggcgagaccgtcagcgtc
gcaggtgagggcaacggcggcatcatcttcccgggctaccggatcgcccgagacggggcc
tacaccgccgggaagttcctcgaactcgtcgccgaggaacccgcaagcgagatcgccgcc
cgcttcgacgactacgtcaacgtccgcgcggccgtcgagtacgaagacgagacagagcgc
gcggcgatgctcgacgccgtcgaagcggccgccaccgaggccgtcgcggacctcgatacg
accgatggctaccggctgaactacggcgacgggtgggtcctggcccgtccgtcggggacc
gagcccgtcgtccggatctacgccgaggcccacacccagcagcgggcagacgagctgcta
tcgaccttcgcggacccgatcgatcgagtccgcgaagacgggtga

DBGET integrated database retrieval system