KEGG   Halomicrobium mukohataei: Hmuk_1603Help
Entry
Hmuk_1603         CDS       T00982                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hmu  Halomicrobium mukohataei
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hmu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1527700..1528500)
Genome map
AA seq 266 aa AA seqDB search
MFPGAATDPDAADYVLVGAPLDASTTFEPGTRFGPRRVRHYAESFEDYDRRTDQRFTELA
VADHGDIGPTDDVADYLAFLRGTVRDYADDGAIPILVGGEHTVSVAGVRALDPDVFCCLD
AHLDLREEYAGNSLSHATVTRHALAVADRAIVLGARSGCRSEWERASEADVTVVEPDAVA
DWEPDFEDERVYCSLDIDAADPGFAPGTGTREPFGLTPRVLRDVVRAVAPHAVGFDVVEV
NDRDDGQAAVLAGKLLRSFVFAHADS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttccctggcgcggccacagaccccgacgcggccgactacgtcctcgtcggtgcgcca
ctcgacgcctcgacgacgttcgagcccgggacgcgcttcgggccgcgccgcgtccgccac
tacgccgagtcgttcgaggactacgatcggcggaccgaccagcggttcaccgagctcgcc
gtcgccgaccacggcgacatcggtccgaccgacgacgtggccgactatctggcctttctc
cgcggcaccgtccgggactacgccgacgacggggcgataccgatcctggtcggcggagaa
cacaccgtctccgtcgccggggttcgggcgctcgatccggacgtgttttgctgtctcgac
gcccacctcgacctccgcgaagagtacgccggcaactccctgagccacgcgaccgtcacg
cgccacgcgctggccgtcgccgaccgggcgatcgttctgggtgcccgcagcggctgtcga
agcgagtgggagcgtgcgagcgaggccgacgtgaccgtcgtcgagcccgacgcggtcgcg
gactgggagcccgacttcgaggacgagcgggtgtactgctcgctcgacatcgacgccgcc
gatccgggcttcgcacccggcaccggtaccagagagccgttcgggctgaccccacgtgtg
ctacgcgacgtggttcgggcggtcgcaccccacgccgtcggcttcgacgtggtcgaggtc
aacgaccgcgacgacgggcaggctgcggtgctcgccggaaagctgctgcgttcgttcgtg
ttcgcacacgcggacagctga

DBGET integrated database retrieval system