KEGG   Halomicrobium mukohataei: Hmuk_1948Help
Entry
Hmuk_1948         CDS       T00982                                 

Definition
glyoxalase/bleomycin resistance protein/dioxygenase
Orthology
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
hmu  Halomicrobium mukohataei
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hmuk_1948
Enzymes [BR:hmu01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     Hmuk_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1857914..1858666
Genome map
AA seq 250 aa AA seqDB search
MGLTLDHTMIRVEDLDESLDWYTTHLGYEEKGRWEAETFTNVFLGPEDVHEDGALLELTY
NHDGRTYEMGDAWGHIAVRVGDVTEAYHELMDEGVEDYRPPEENPGYAFVKDPDGHEIEI
VERDHGARYSLDHTMLRVEDADAAIGWYARKLGFEPAGRWEADTFANYFMADPDAAQEAM
TVELTYNYDGRTYEMGDAWGHIAARADDLEDAWESLMVREAEEYRDPESCDYNYAFTKDA
DGHEVEIVTS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggactgaccctcgaccacacgatgatccgcgtcgaagatctcgacgaatcgctcgac
tggtacaccacacacctcggttacgaggagaagggtcgctgggaggccgagacgttcacc
aacgtcttcctcggtcccgaggacgtacacgaggacggtgccctgctggaactcacgtac
aaccacgacgggcgcacgtacgaaatgggcgacgcctggggtcacatcgcggtccgcgtc
ggggacgtgaccgaggcctaccacgagctgatggacgagggcgtcgaagactaccgcccg
cccgaggaaaaccccggctacgccttcgtgaaagaccccgacggccacgagatcgagatc
gtcgaacgcgaccacggcgcacgctacagcctcgatcacacgatgctccgcgttgaggac
gccgacgctgcgatcggctggtacgcccgcaagctgggcttcgagcccgccgggcgctgg
gaggccgacaccttcgcgaactacttcatggccgaccccgacgccgcccaggaggcgatg
accgtcgaactcacgtacaactacgacgggcgcacgtacgagatgggcgacgcgtggggc
cacatcgcagcccgcgccgacgacctcgaagacgcgtgggagtcgctgatggttcgtgaa
gccgaggagtaccgcgaccccgaatcctgtgactacaactacgcgttcacgaaagacgcc
gacggccacgaagtcgagatcgtcacgtcgtaa

DBGET integrated database retrieval system