KEGG   Halomicrobium mukohataei: Hmuk_2056Help
Entry
Hmuk_2056         CDS       T00982                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hmuk_2056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_2056
   00620 Pyruvate metabolism
    Hmuk_2056
   00640 Propanoate metabolism
    Hmuk_2056
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2056
   00680 Methane metabolism
    Hmuk_2056
Enzymes [BR:hmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hmuk_2056
Lipid biosynthesis proteins [BR:hmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hmuk_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1964571..1966562)
Genome map
AA seq 663 aa AA seqDB search
MGEFVHVPDEAFVEATNVARFMRTYDIADYEELIARTTGQVDGEPASGIDWFWDEIVDYL
DIEFYEPYDQIRDDTDGPQFTRWYPGGTVNLAHNVVDRHAALDSEARNRVACIWEGEPGE
QRHVTYHDLHRQANRVANALRERGIERGDTVGLYMPMVPEVVSILYGCFKLGAIAVPIFS
GFGVDATATRIADSDCSVLFTADGFYRRGDEIRLKDAVDEAIEQAGSVTDTVVFDRLGAV
DEIPWTDRDERWADAVGTADATFETERLDANDESMLLYSSGTTGEPKGIVHTHAGVQVQT
AKELHFGFDLQPADRFFWVSDIGWMMGPWTLIGTHTFGGTVFMYEGAPDHPGPDRFWDMI
ERHGLTQFGISPTAIRALRKHGTGPLEAHDLSSLRLLGSTGEPWDDESWRWFYEHVGGGE
TPIINISGGTEICGCFLMPMPIQPLKPCTLGGPGLGMDVDIVDSTGESVADDHERGFLVA
RDSCPSTTKSLWSGDERYLEEYWSTWEDCWDHGDWAQKDEDGLWYLHGRADDALNVAGRK
VGPAEVEGALIAHDAVNQAAAVGVPDDTTGTAVAAFVVLEDGVEAGEDLRADLRSQVGRE
LGKPFRPRDVVFVDGFPKTQSGKIVRRAVAGAYTGETIGDTSSIENPETIDALAAAASEQ
REG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagttcgtccacgtccccgacgaggcgttcgtcgaggcgacaaacgtcgcccgg
ttcatgcggacctacgacatcgccgactacgaggaactgatcgcacgcaccaccgggcaa
gtagacggagagcccgcgtccgggatcgactggttctgggacgagatcgtcgactacctc
gacatcgagttctacgaaccgtacgaccagatccgggacgacacggacggcccgcagttc
acccgatggtaccccggcggcaccgtcaacctcgcgcacaacgtcgtggatcgccacgcc
gccctcgacagcgaggcgcgcaaccgcgtggcctgcatctgggagggcgaacccggcgag
cagcgccacgtcacgtaccacgacctccaccgacaggccaaccgcgtggccaacgcgctc
cgggagcggggcatcgagcggggggacacggtcggcctgtacatgccgatggtccccgaa
gtcgtctcgatcctgtacggctgtttcaagctgggagcgatcgccgtcccgatcttctcc
ggtttcggcgtcgacgcgaccgcgacccggatcgcagacagcgactgttccgtgctcttt
accgccgacggattctaccggcgcggcgacgagatccggctgaaagacgccgtcgacgag
gccatcgagcaggccggcagcgtcacagacaccgtcgtcttcgaccgcctgggtgcagtc
gacgagatcccatggaccgatcgcgacgagcggtgggccgacgccgtcggaaccgccgac
gcgaccttcgagaccgagcgcctcgacgcgaacgacgagtcgatgctgctgtactcttct
gggaccaccggcgaacccaaagggatcgtccacacgcacgccggagtccaggtgcagacg
gcgaaggaactacacttcgggttcgacctgcagcccgcagatcggttcttctgggtctcc
gacatcggctggatgatgggcccctggacgctgatcgggacccacacgttcggcggcacc
gtcttcatgtacgagggcgcgcccgaccaccccggcccggaccgattctgggacatgatc
gaacgccacggactgacccagttcggcatcagtccgacggcgatccgtgcgcttcgcaag
cacggtaccggccccctcgaggcccacgacctctcgtcgctgcggttgctgggatcgacg
ggcgaaccctgggacgacgagtcctggcggtggttctacgagcacgtcggcggcggcgag
accccgatcatcaacatctccggcggcaccgagatctgcgggtgcttcctcatgccgatg
ccgatccagcccctcaagccctgcacgctgggcggcccggggctggggatggacgtcgac
atcgtcgacagcaccggcgagtccgtcgcggacgaccacgagcggggctttctggtggca
cgggactcctgtcccagcacgacgaagtccctgtggagcggcgacgagcgctacctcgaa
gagtactggtcgacgtgggaggactgctgggaccacggcgactgggctcagaaagacgag
gacggactctggtacctccacggccgagccgacgacgcgctcaacgtcgccgggcggaag
gtcggccccgcagaggtcgagggggcactgatcgcacacgacgccgtcaatcaggccgcc
gccgtcggagtgccagacgacacgacgggcaccgccgtcgccgcgttcgtcgtcctcgaa
gacggtgtcgaggcaggcgaggaccttcgggcagacctgcgctcgcaggtcggtcgcgaa
ctcggcaagccgttccgtccccgagacgtcgtgttcgtcgacggcttccccaagacacag
agcggcaagatcgtccgccgggccgtcgcgggtgcctacaccggcgagacgatcggcgac
accagcagcatcgagaatccggagacgatcgacgcgctggcggcggccgccagcgaacaa
cgtgaggggtga

DBGET integrated database retrieval system