KEGG   Halomicrobium mukohataei: Hmuk_2056Help
Entry
Hmuk_2056         CDS       T00982                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00010  Glycolysis / Gluconeogenesis
hmu00620  Pyruvate metabolism
hmu00640  Propanoate metabolism
hmu00680  Methane metabolism
hmu00720  Carbon fixation pathways in prokaryotes
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
hmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_2056
   00620 Pyruvate metabolism
    Hmuk_2056
   00640 Propanoate metabolism
    Hmuk_2056
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2056
   00680 Methane metabolism
    Hmuk_2056
Enzymes [BR:hmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hmuk_2056
Lipid biosynthesis proteins [BR:hmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hmuk_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: ACV48169
JGI: Hmuk_2056
UniProt: C7NW40
Position
complement(1964571..1966562)
Genome map
AA seq 663 aa AA seqDB search
MGEFVHVPDEAFVEATNVARFMRTYDIADYEELIARTTGQVDGEPASGIDWFWDEIVDYL
DIEFYEPYDQIRDDTDGPQFTRWYPGGTVNLAHNVVDRHAALDSEARNRVACIWEGEPGE
QRHVTYHDLHRQANRVANALRERGIERGDTVGLYMPMVPEVVSILYGCFKLGAIAVPIFS
GFGVDATATRIADSDCSVLFTADGFYRRGDEIRLKDAVDEAIEQAGSVTDTVVFDRLGAV
DEIPWTDRDERWADAVGTADATFETERLDANDESMLLYSSGTTGEPKGIVHTHAGVQVQT
AKELHFGFDLQPADRFFWVSDIGWMMGPWTLIGTHTFGGTVFMYEGAPDHPGPDRFWDMI
ERHGLTQFGISPTAIRALRKHGTGPLEAHDLSSLRLLGSTGEPWDDESWRWFYEHVGGGE
TPIINISGGTEICGCFLMPMPIQPLKPCTLGGPGLGMDVDIVDSTGESVADDHERGFLVA
RDSCPSTTKSLWSGDERYLEEYWSTWEDCWDHGDWAQKDEDGLWYLHGRADDALNVAGRK
VGPAEVEGALIAHDAVNQAAAVGVPDDTTGTAVAAFVVLEDGVEAGEDLRADLRSQVGRE
LGKPFRPRDVVFVDGFPKTQSGKIVRRAVAGAYTGETIGDTSSIENPETIDALAAAASEQ
REG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagttcgtccacgtccccgacgaggcgttcgtcgaggcgacaaacgtcgcccgg
ttcatgcggacctacgacatcgccgactacgaggaactgatcgcacgcaccaccgggcaa
gtagacggagagcccgcgtccgggatcgactggttctgggacgagatcgtcgactacctc
gacatcgagttctacgaaccgtacgaccagatccgggacgacacggacggcccgcagttc
acccgatggtaccccggcggcaccgtcaacctcgcgcacaacgtcgtggatcgccacgcc
gccctcgacagcgaggcgcgcaaccgcgtggcctgcatctgggagggcgaacccggcgag
cagcgccacgtcacgtaccacgacctccaccgacaggccaaccgcgtggccaacgcgctc
cgggagcggggcatcgagcggggggacacggtcggcctgtacatgccgatggtccccgaa
gtcgtctcgatcctgtacggctgtttcaagctgggagcgatcgccgtcccgatcttctcc
ggtttcggcgtcgacgcgaccgcgacccggatcgcagacagcgactgttccgtgctcttt
accgccgacggattctaccggcgcggcgacgagatccggctgaaagacgccgtcgacgag
gccatcgagcaggccggcagcgtcacagacaccgtcgtcttcgaccgcctgggtgcagtc
gacgagatcccatggaccgatcgcgacgagcggtgggccgacgccgtcggaaccgccgac
gcgaccttcgagaccgagcgcctcgacgcgaacgacgagtcgatgctgctgtactcttct
gggaccaccggcgaacccaaagggatcgtccacacgcacgccggagtccaggtgcagacg
gcgaaggaactacacttcgggttcgacctgcagcccgcagatcggttcttctgggtctcc
gacatcggctggatgatgggcccctggacgctgatcgggacccacacgttcggcggcacc
gtcttcatgtacgagggcgcgcccgaccaccccggcccggaccgattctgggacatgatc
gaacgccacggactgacccagttcggcatcagtccgacggcgatccgtgcgcttcgcaag
cacggtaccggccccctcgaggcccacgacctctcgtcgctgcggttgctgggatcgacg
ggcgaaccctgggacgacgagtcctggcggtggttctacgagcacgtcggcggcggcgag
accccgatcatcaacatctccggcggcaccgagatctgcgggtgcttcctcatgccgatg
ccgatccagcccctcaagccctgcacgctgggcggcccggggctggggatggacgtcgac
atcgtcgacagcaccggcgagtccgtcgcggacgaccacgagcggggctttctggtggca
cgggactcctgtcccagcacgacgaagtccctgtggagcggcgacgagcgctacctcgaa
gagtactggtcgacgtgggaggactgctgggaccacggcgactgggctcagaaagacgag
gacggactctggtacctccacggccgagccgacgacgcgctcaacgtcgccgggcggaag
gtcggccccgcagaggtcgagggggcactgatcgcacacgacgccgtcaatcaggccgcc
gccgtcggagtgccagacgacacgacgggcaccgccgtcgccgcgttcgtcgtcctcgaa
gacggtgtcgaggcaggcgaggaccttcgggcagacctgcgctcgcaggtcggtcgcgaa
ctcggcaagccgttccgtccccgagacgtcgtgttcgtcgacggcttccccaagacacag
agcggcaagatcgtccgccgggccgtcgcgggtgcctacaccggcgagacgatcggcgac
accagcagcatcgagaatccggagacgatcgacgcgctggcggcggccgccagcgaacaa
cgtgaggggtga

DBGET integrated database retrieval system