KEGG   Halomicrobium mukohataei: Hmuk_2056Help
Entry
Hmuk_2056         CDS       T00982                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hmuk_2056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_2056
   00620 Pyruvate metabolism
    Hmuk_2056
   00640 Propanoate metabolism
    Hmuk_2056
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2056
   00680 Methane metabolism
    Hmuk_2056
Enzymes [BR:hmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hmuk_2056
Lipid biosynthesis proteins [BR:hmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hmuk_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1964571..1966562)
Genome map
AA seq 663 aa AA seqDB search
MGEFVHVPDEAFVEATNVARFMRTYDIADYEELIARTTGQVDGEPASGIDWFWDEIVDYL
DIEFYEPYDQIRDDTDGPQFTRWYPGGTVNLAHNVVDRHAALDSEARNRVACIWEGEPGE
QRHVTYHDLHRQANRVANALRERGIERGDTVGLYMPMVPEVVSILYGCFKLGAIAVPIFS
GFGVDATATRIADSDCSVLFTADGFYRRGDEIRLKDAVDEAIEQAGSVTDTVVFDRLGAV
DEIPWTDRDERWADAVGTADATFETERLDANDESMLLYSSGTTGEPKGIVHTHAGVQVQT
AKELHFGFDLQPADRFFWVSDIGWMMGPWTLIGTHTFGGTVFMYEGAPDHPGPDRFWDMI
ERHGLTQFGISPTAIRALRKHGTGPLEAHDLSSLRLLGSTGEPWDDESWRWFYEHVGGGE
TPIINISGGTEICGCFLMPMPIQPLKPCTLGGPGLGMDVDIVDSTGESVADDHERGFLVA
RDSCPSTTKSLWSGDERYLEEYWSTWEDCWDHGDWAQKDEDGLWYLHGRADDALNVAGRK
VGPAEVEGALIAHDAVNQAAAVGVPDDTTGTAVAAFVVLEDGVEAGEDLRADLRSQVGRE
LGKPFRPRDVVFVDGFPKTQSGKIVRRAVAGAYTGETIGDTSSIENPETIDALAAAASEQ
REG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagttcgtccacgtccccgacgaggcgttcgtcgaggcgacaaacgtcgcccgg
ttcatgcggacctacgacatcgccgactacgaggaactgatcgcacgcaccaccgggcaa
gtagacggagagcccgcgtccgggatcgactggttctgggacgagatcgtcgactacctc
gacatcgagttctacgaaccgtacgaccagatccgggacgacacggacggcccgcagttc
acccgatggtaccccggcggcaccgtcaacctcgcgcacaacgtcgtggatcgccacgcc
gccctcgacagcgaggcgcgcaaccgcgtggcctgcatctgggagggcgaacccggcgag
cagcgccacgtcacgtaccacgacctccaccgacaggccaaccgcgtggccaacgcgctc
cgggagcggggcatcgagcggggggacacggtcggcctgtacatgccgatggtccccgaa
gtcgtctcgatcctgtacggctgtttcaagctgggagcgatcgccgtcccgatcttctcc
ggtttcggcgtcgacgcgaccgcgacccggatcgcagacagcgactgttccgtgctcttt
accgccgacggattctaccggcgcggcgacgagatccggctgaaagacgccgtcgacgag
gccatcgagcaggccggcagcgtcacagacaccgtcgtcttcgaccgcctgggtgcagtc
gacgagatcccatggaccgatcgcgacgagcggtgggccgacgccgtcggaaccgccgac
gcgaccttcgagaccgagcgcctcgacgcgaacgacgagtcgatgctgctgtactcttct
gggaccaccggcgaacccaaagggatcgtccacacgcacgccggagtccaggtgcagacg
gcgaaggaactacacttcgggttcgacctgcagcccgcagatcggttcttctgggtctcc
gacatcggctggatgatgggcccctggacgctgatcgggacccacacgttcggcggcacc
gtcttcatgtacgagggcgcgcccgaccaccccggcccggaccgattctgggacatgatc
gaacgccacggactgacccagttcggcatcagtccgacggcgatccgtgcgcttcgcaag
cacggtaccggccccctcgaggcccacgacctctcgtcgctgcggttgctgggatcgacg
ggcgaaccctgggacgacgagtcctggcggtggttctacgagcacgtcggcggcggcgag
accccgatcatcaacatctccggcggcaccgagatctgcgggtgcttcctcatgccgatg
ccgatccagcccctcaagccctgcacgctgggcggcccggggctggggatggacgtcgac
atcgtcgacagcaccggcgagtccgtcgcggacgaccacgagcggggctttctggtggca
cgggactcctgtcccagcacgacgaagtccctgtggagcggcgacgagcgctacctcgaa
gagtactggtcgacgtgggaggactgctgggaccacggcgactgggctcagaaagacgag
gacggactctggtacctccacggccgagccgacgacgcgctcaacgtcgccgggcggaag
gtcggccccgcagaggtcgagggggcactgatcgcacacgacgccgtcaatcaggccgcc
gccgtcggagtgccagacgacacgacgggcaccgccgtcgccgcgttcgtcgtcctcgaa
gacggtgtcgaggcaggcgaggaccttcgggcagacctgcgctcgcaggtcggtcgcgaa
ctcggcaagccgttccgtccccgagacgtcgtgttcgtcgacggcttccccaagacacag
agcggcaagatcgtccgccgggccgtcgcgggtgcctacaccggcgagacgatcggcgac
accagcagcatcgagaatccggagacgatcgacgcgctggcggcggccgccagcgaacaa
cgtgaggggtga

DBGET integrated database retrieval system