KEGG   Halomicrobium mukohataei: Hmuk_2077Help
Entry
Hmuk_2077         CDS       T00982                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hmu  Halomicrobium mukohataei
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hmuk_2077
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hmuk_2077
   00650 Butanoate metabolism
    Hmuk_2077
  Energy metabolism
   00190 Oxidative phosphorylation
    Hmuk_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1987128..1987493
Genome map
AA seq 121 aa AA seqDB search
MAEHYSSFERKGSRWLLQRITAVFLIGVLAFHFMLLHFVNHAAEVTLAGTTTRMSSIGYF
TTMWLFLVTATFHGVNGVYNALINQGLTGTRKRAVKWVLVVAGVLLIAQGTRVAVAMTNL
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacactactcctctttcgaacggaagggatcgcggtggctgctacagcggatc
acggcggtgttcctgatcggcgtgctggccttccacttcatgctgctgcacttcgtcaac
cacgcggcggaggtcacgctggccggcacgaccacccggatgagctccatcggctacttc
acgacgatgtggctgttcctcgtgaccgcgaccttccacggcgtcaacggcgtctacaac
gccctcatcaaccagggtctgaccgggactcgcaagcgagcggtcaagtgggtgctggtc
gtcgccggtgtcctgctgatcgcacagggaacccgcgtcgccgtcgccatgaccaacctg
atctaa

DBGET integrated database retrieval system