KEGG   Halomicrobium mukohataei: Hmuk_2077Help
Entry
Hmuk_2077         CDS       T00982                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00020  Citrate cycle (TCA cycle)
hmu00190  Oxidative phosphorylation
hmu00650  Butanoate metabolism
hmu00720  Carbon fixation pathways in prokaryotes
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
hmu01200  Carbon metabolism
Module
hmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hmu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hmuk_2077
   00650 Butanoate metabolism
    Hmuk_2077
  Energy metabolism
   00190 Oxidative phosphorylation
    Hmuk_2077
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF2517 DUF1673
Motif
Other DBs
NCBI-ProteinID: ACV48190
JGI: Hmuk_2077
UniProt: C7NW61
Position
1987128..1987493
Genome map
AA seq 121 aa AA seqDB search
MAEHYSSFERKGSRWLLQRITAVFLIGVLAFHFMLLHFVNHAAEVTLAGTTTRMSSIGYF
TTMWLFLVTATFHGVNGVYNALINQGLTGTRKRAVKWVLVVAGVLLIAQGTRVAVAMTNL
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacactactcctctttcgaacggaagggatcgcggtggctgctacagcggatc
acggcggtgttcctgatcggcgtgctggccttccacttcatgctgctgcacttcgtcaac
cacgcggcggaggtcacgctggccggcacgaccacccggatgagctccatcggctacttc
acgacgatgtggctgttcctcgtgaccgcgaccttccacggcgtcaacggcgtctacaac
gccctcatcaaccagggtctgaccgggactcgcaagcgagcggtcaagtgggtgctggtc
gtcgccggtgtcctgctgatcgcacagggaacccgcgtcgccgtcgccatgaccaacctg
atctaa

DBGET integrated database retrieval system