KEGG   Halomicrobium mukohataei: Hmuk_2098Help
Entry
Hmuk_2098         CDS       T00982                                 

Definition
(GenBank) peptidase M42 family protein
Organism
hmu  Halomicrobium mukohataei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2005260..2006321)
Genome map
AA seq 353 aa AA seqDB search
MDEDRRKFLDELLSTATPSGYETAGQRVWIDYVESYADEVRVDDYGNAVAVLKGSGDAEV
ALAGHGDEIGFIVRDVTDDGFLRIDRIGGSDSTVSRGQHVTVHTDNDPIDGVVGQTAIHL
RNGEDDDVPGINEQHVDIGAEDGDEAEELVSRGDPITFEQTISELQNGYLSARGMDNRIG
IWAAAEGLRRAAETGTDATVYAVSTVQEEVGVQGAKMVGFDLDPDAAIAVDVTHATDQPD
SPGKRSSGVALGDGPVIARGSANHPALVDAVRDTAESEDIDVQLQATGNRTGTDADAFYT
SRGGIPSLNVGLPNRYMHTPVEVIDPADLEAVADLLAGFAAQADALAPFSVDL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggaccgacgcaagtttctcgacgaactgctctcgaccgcgacgccctcgggc
tacgagacggcgggccagcgagtctggatcgactacgtggaatcgtacgccgacgaggtg
agagtcgacgactacggcaacgccgtcgcggtactgaagggaagcggtgacgccgaggtc
gcgctggcgggccacggcgacgagatcggcttcatcgtccgggacgtgaccgacgacggc
ttcctgcggatcgaccgtatcggcggctcggacagcaccgtctcgcggggccagcacgtc
accgtccacaccgacaacgacccgatcgacggcgtcgtcggacagacggcgatccacctg
cgaaacggcgaggacgacgacgttcccgggatcaacgaacaacacgtcgacatcggggcc
gaggacggcgacgaggccgaggaactggtctcgcgtggcgacccgatcaccttcgagcag
acgatcagcgaactgcagaacggctacctctcggcccgcgggatggacaaccgaatcggc
atctgggccgccgcggagggactccgacgggccgcggagaccggaaccgacgcgacggtc
tacgccgtctcgacggtccaggaggaagtgggcgtccagggcgcgaagatggtcggcttc
gacctcgatccggacgccgcgatcgccgtggacgtgacccacgcgaccgatcagccggac
tcgccgggcaagcgctccagcggcgtcgcgctcggggatggcccggtgatcgcccgcggc
agcgcgaaccaccccgcgctggtcgatgcggtcagagacaccgccgagagcgaggacatc
gacgtgcagttgcaggcgactggcaaccgaaccggcaccgacgccgacgccttctacacg
tcgcgtggcgggatcccgtcgctcaacgtcggtctccccaaccgctacatgcacaccccc
gtcgaggtgatcgacccggcagacctcgaagccgtggcagacctcctggccggcttcgcg
gcccaggccgacgcgctcgcaccgttcagcgtcgacctgtga

DBGET integrated database retrieval system