KEGG   Halomicrobium mukohataei: Hmuk_2192Help
Entry
Hmuk_2192         CDS       T00982                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
hmu  Halomicrobium mukohataei
Brite
Enzymes [BR:hmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Hmuk_2192
Transfer RNA biogenesis [BR:hmu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Hmuk_2192
Chromosome and associated proteins [BR:hmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Hmuk_2192
   HAT complexes
    Elongator complex
     Hmuk_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: ACV48305
JGI: Hmuk_2192
UniProt: C7NWU5
Position
complement(2106688..2108418)
Genome map
AA seq 576 aa AA seqDB search
MEAASGRSSDTLIRASERTVTTAMSTETGDPTESEAFEQVCAELVDRILAGELEREDVES
AKMEVCSKYSAPKVPKNSEILDYAPLERREELEEVLQRKPVRTASGVSPIAVMTSPHRCP
HGKCLYCPGGPDSEFSSSQSYTGHEPAAARGVQNDYDPYGQVTLRLNQLREIGHPVDKAE
LIIMGGTMTARSHDYQEWFVKRALEAMNDFDAGAQPQPAEDVSFAEDPDEYDFRYLEDVI
TENETADVRNVATTFETKPDWCDPEQIDRMLRLGGTKVEVGVQTTYERINREMHRGHGVQ
ASVDANRRLRDSAFKVGFHMMPGQPGMSKEMCLEDFRRIFEDSKWRPDYLKIYPTLVVEG
TVTYDWYRKDEFEPLDNDEAAELVAEIKSMIPKYTRLQRVQRDIPADFIEGGVWKSNLRQ
LARQRMDEHGWTCDCIRCREVGMNDEDPERIEKDVLTYEAAGGTEHFISFEDPDKDLLIG
FCRLRFPNDPVRRELQNAALVRELHVYGSQVGLGSASEDDQHQHEGYGRRLLATAEELAA
DAGYDKLAVISGIGVRQYYREKLDYKQDGPYVSKRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagccagcgggaggagtagcgacacgcttattcgcgcgagcgaacgaactgtg
acaacggcaatgagcaccgagacgggtgatccgacggagtccgaggcgttcgagcaggtc
tgtgcggagctggtcgaccgcatcctcgcgggcgaactggagcgcgaggacgtggaaagc
gccaagatggaggtctgttcgaagtactccgcgccgaaggtccccaagaactccgagatc
ctcgactacgcgccactggagcgacgcgaagagctcgaggaagtgctccagcgcaagccg
gtgcggaccgcttcgggcgtctcgccgatcgcggtgatgacctctccccaccggtgtcca
cacgggaagtgtctctactgtcccggcgggcccgattcggagttttcgtcctcccagtcc
tacaccggccacgagcccgcagcggcccgcggcgtccagaacgactacgacccctacgga
caggtgacgctgcggctgaaccaactgcgcgagatcggccaccccgtcgacaaggccgaa
ctaatcatcatgggtgggacgatgaccgcccggagccacgactaccaggagtggttcgtc
aagcgtgcgctcgaagcgatgaacgacttcgacgccggggcccagccccagcccgcggaa
gacgtgagtttcgccgaagaccccgacgagtacgactttcgctacctcgaagacgtgatc
accgagaacgagaccgccgacgtgcgaaacgtcgccacgaccttcgagacgaagcccgac
tggtgcgatcccgagcagatcgaccggatgctcaggctgggcgggacgaaggtcgaagtc
ggggtccagaccacctacgagcggatcaaccgcgagatgcaccgcggtcacggcgtccag
gccagcgtcgacgcgaaccgccggctgcgcgactcggcgttcaaggtcggcttccacatg
atgcccggccagcccggcatgtccaaggagatgtgcctggaggacttccggcgcatcttc
gaggacagcaagtggcgaccggactacctcaagatctacccgacgctggtcgtcgagggg
accgtcacctacgactggtaccgcaaggacgagttcgagccactggacaacgacgaggcc
gcggagctggtcgccgagatcaagtcgatgatcccgaagtacacgcgcctccagcgcgtc
cagcgtgacatccccgcggacttcatcgagggcggcgtctggaagtccaacctccgacag
ctcgcccgacagcgcatggacgaacacggctggacctgcgactgcatccgctgtcgcgag
gtcgggatgaacgacgaggacccagagcgcatcgagaaagacgtgctgacctacgaggcc
gccggcggcaccgagcacttcatcagcttcgaggaccccgacaaggatctgctgatcggc
ttctgtcggctccgattcccgaacgacccggttcgccgcgaactgcaaaacgccgcgctc
gtgcgggaactccacgtctacggcagccaggtcggcctcgggagcgccagcgaggacgac
caacaccagcacgagggatacggtcgccgactgctcgcgacggcggaggaactggcggcc
gacgccggctacgacaagctcgcggtcatctccggtatcggcgtccggcagtactaccgc
gagaagctcgactacaagcaagacggtccgtacgtcagcaagcggctgtaa

DBGET integrated database retrieval system