KEGG   Halomicrobium mukohataei: Hmuk_2301Help
Entry
Hmuk_2301         CDS       T00982                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hmu  Halomicrobium mukohataei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hmu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hmu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2221250..2222164
Genome map
AA seq 304 aa AA seqDB search
MRQDHIISAKQLSRRDIEAVLDRAAEIAADPSAYADRHEGSLLGLLFFEPSTRTKMSFSA
AMKRLGGDIVDMGTVESSSVKKGESLADTVRVVEGYADALVLRHPSEGAAQMASEFVDAP
LINAGDGAGQHPTQTLLDLYTIRENAGFDDLSIGIMGDLKYGRTVHSLAHALTVFDARQH
FVSPESLQLPRSVRYDLHESGAEVREHTDLDDVLSELDVLYVTRIQKERFPDESEYHEVA
GEYQIDAATIREHNEDLTVMHPLPRVDEIDHDVDELDGAQYFQQAHNGVPVRMALLDMVL
EESR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaggaccacatcatcagcgccaaacagctctcccgccgggacatcgaggcggtg
ctggaccgcgctgccgagatcgcggcggatccgtcggcctacgcggaccgacacgagggg
tccctgctcggcctcctctttttcgaacccagtacccggacgaagatgagtttcagtgcc
gcaatgaaacgcctcggcggcgacatcgtcgacatgggcacggtcgagtcctccagcgtc
aagaaaggcgagtcgctggcagacaccgtccgcgtcgtcgagggctacgccgacgcgctc
gtcttgcgccacccgagcgagggcgcggcccagatggccagcgagttcgtcgacgcgccg
ctgatcaacgcgggcgacggtgcgggccagcacccgacacagacgctcctggatctgtac
acgatccgcgagaacgccggcttcgacgacctctcgatcgggatcatgggcgacctgaag
tacggccgcaccgtccactcgctggcacacgccctgacggtcttcgacgctcgccagcac
ttcgtcagccccgagagcctccaactgccccgctcggtgcggtacgacctccacgaatcc
ggcgcggaggtccgcgagcacaccgacctcgacgacgtgctgtcggaactggacgttctc
tacgtcacccggatccagaaagagcggttccccgacgagagcgagtaccacgaggtcgcc
ggggagtaccagatcgacgcggcgacgatccgcgagcacaacgaggatctgacggtcatg
cacccgctcccgcgagtcgacgagatcgaccacgacgtggacgaactcgacggcgcacag
tacttccagcaggcacacaacggcgtccccgtccggatggcgctcctggacatggttctg
gaggaatcacgatga

DBGET integrated database retrieval system