KEGG   Halomicrobium mukohataei: Hmuk_2370Help
Entry
Hmuk_2370         CDS       T00982                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hmu  Halomicrobium mukohataei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hmuk_2370
   01230 Biosynthesis of amino acids
    Hmuk_2370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_2370
   00051 Fructose and mannose metabolism
    Hmuk_2370
   00562 Inositol phosphate metabolism
    Hmuk_2370
Enzymes [BR:hmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hmuk_2370
Exosome [BR:hmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hmuk_2370
  Exosomal proteins of bladder cancer cells
   Hmuk_2370
  Exosomal proteins of melanoma cells
   Hmuk_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2281594..2282268)
Genome map
AA seq 224 aa AA seqDB search
MIPASGGLCMFVLVNLKAYPCDPIEVATAAADVSDETGVRVAVAPQAAHLDAVAETGVET
WAQHVSPVEHGSHTGSTLAEAAVDAGATGTLLNHSENRLKLADIDGSLDAADRADLETIV
CANNPEQIAAAAALGPDAVAVEPPALIGTGTPVSKADPEIVTDAVSAAASVDESVDVLCG
AGISTGEDVVSAGELGASGVLLASGVAKADDPRAALEDLVAPLE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggcgtccggtgggctctgtatgttcgttctggtgaacctcaaagcgtacccg
tgtgatccgatcgaagtcgcgaccgccgccgccgacgtgagcgacgagaccggcgttcgc
gtcgccgtcgcgcctcaggcggcccacctcgacgccgtcgccgagaccggtgtcgagacg
tgggcccagcacgtcagtcccgtcgagcacggcagccacaccggctccacgctcgcggag
gccgcggtcgacgccggtgcgaccgggacgctgttgaaccactccgagaaccgactgaag
ctggccgacatcgacggctcgctggacgccgccgaccgcgcggacctggagacgatcgtc
tgtgccaacaacccagaacagatcgccgccgcggcggcgctgggaccggacgccgtcgcc
gtcgagccgcccgccctgatcgggaccgggacgccggtcagcaaggccgacccggagatc
gtcacggacgcggtctcggccgcggcgtcggtcgacgagagcgtcgacgtgctctgtggc
gctggcatctcgaccggcgaagacgtggtgtcggccggcgaactcggtgcgagcggcgtc
ctgctcgcgagcggcgtcgccaaggccgacgatccgcgggccgcgctggaagacctggtc
gcaccgctggagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system