KEGG   Halomicrobium mukohataei: Hmuk_2450Help
Entry
Hmuk_2450         CDS       T00982                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hmu  Halomicrobium mukohataei
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hmu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2351580..2352854
Genome map
AA seq 424 aa AA seqDB search
MNVRRVGDLGPDERRALFERDAGVDEVRDDVQEIVDRVRKEGDVALREFAEEFDGVTVGN
VDITDDAERAVEEIDAATLSAIEDAAENVRAFHEAQLPTDWRDSFEGRELGRRYRPIESA
GAYVPGGTAAYPSSALMGVIPAKVAGVEHVAVATPPAEEINPVTLAAIHVAGADVVYQAG
GAQAIAALAYGTESVDAVDKVVGPGNRWVTAAKSIVRGDVAIDFLAGPSEIMVVADESAD
PELVAADLVAQAEHDENASVVAVTDDEELAEAVAAAVDSQADARDREAVIRGALDSAASG
VFLARSMSEAVLFAEEYAAEHLSIVAEDDESILDRIPSAGSAFLGPHSAVAAGDYASGPN
HVLPTGGHARVTGGLSVDSFLRSTTVQRLSEESLADIESTITTLAEAEGLEAHAESVRKR
FDDA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacgacgcgtcggagacctcggtccggacgagcgccgcgcgctgttcgagcgc
gatgccggcgtcgacgaggtccgcgacgacgtgcaggagatcgtcgatcgggtccgaaaa
gagggcgacgttgcgctgcgggagttcgccgaagagttcgacggcgtcaccgtcggtaac
gtcgacatcaccgacgacgccgaacgcgccgtcgaggagatcgatgcggcgacactgtcg
gccatcgaggacgccgccgaaaacgtcagagcgttccacgaggcacagttgccgaccgac
tggcgcgactccttcgaggggcgcgaactcggtcgtcgatatcgcccgatcgagagcgcc
ggtgcgtacgtccccggcgggaccgcagcgtacccctccagcgcgctgatgggcgttatc
ccggcgaaagtcgccggtgtcgaacacgtcgccgtcgcgaccccgcccgccgaggagatc
aacccggtgacgctcgcggccatccacgtcgccggtgcggacgtggtgtaccaggccggc
ggcgcgcaggcgatcgccgcactcgcctacgggaccgagtccgtcgacgccgtcgacaag
gtcgtcgggccgggcaaccggtgggtgaccgccgccaagtcgatcgtccggggcgacgtg
gcgatcgatttcctcgccggcccctccgagatcatggtcgtcgccgacgagagcgccgac
ccggaactggtcgccgccgatctcgtcgcccaggccgaacacgacgagaacgcctccgtc
gtcgccgtgaccgacgacgaggagctcgcggaggccgtcgcagcggccgtcgacagccag
gccgacgcgcgcgaccgcgaggccgtgattcgcggggccctcgacagcgcggcctccggg
gtcttcctcgcgcggtcgatgagcgaggcggtgctgttcgccgaagagtacgcggcggag
cacctctcgatcgtcgccgaggacgacgagtcgatactcgaccgcatcccctcggccggg
tcggcgtttctcggcccccacagcgccgtggccgccggtgactacgccagcggaccgaac
cacgtgctaccgacgggcggccacgcgcgcgtcaccggcggactctccgtggactcgttc
ctgcgctcgacgaccgtacagcgcctctccgaggagtcactggccgacatcgagtcgacg
atcaccacgctcgcggaggccgaggggctcgaagcccacgcagagagcgtccgcaagcga
ttcgacgacgcctga

DBGET integrated database retrieval system