KEGG   Halomicrobium mukohataei: Hmuk_2511Help
Entry
Hmuk_2511         CDS       T00982                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00010  Glycolysis / Gluconeogenesis
hmu00052  Galactose metabolism
hmu00500  Starch and sucrose metabolism
hmu00520  Amino sugar and nucleotide sugar metabolism
hmu00521  Streptomycin biosynthesis
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
hmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hmuk_2511
   00052 Galactose metabolism
    Hmuk_2511
   00500 Starch and sucrose metabolism
    Hmuk_2511
   00520 Amino sugar and nucleotide sugar metabolism
    Hmuk_2511
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hmuk_2511
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hmuk_2511
Enzymes [BR:hmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hmuk_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ACV48619
JGI: Hmuk_2511
UniProt: C7NYT0
Position
2410342..2411304
Genome map
AA seq 320 aa AA seqDB search
MAAYAGVDLGATNIRAVVGDESARELGSDTQATPRGPNGIAVTEAILDCLRNACDDADVS
PSSVVAAGIGSIGPLDLAEGIVEGPANLPDSIGRIPLTGPVGNLIDSERVYLHNDTNAGV
IGERFFSDRNPDDMVYLTISSGIGAGVAVDGNVVDGWDGNAGEVGHMTLDPAGVMTCGCG
SDGHWEAYCSGNNIPKYATQLHTEDGMETALPVESGDFDAADVFDRARDGDDFAQYVIGQ
VGHLNAIGIANVVQAYAPLVVYVGGAVALNNPDAVLDPIRDELSEMVFGNIPDVKLTTLG
EDIVVMGALASAITDGTGER
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacgcaggggtggatctcggcgcgacgaacattcgtgctgtcgtcggcgac
gagtccgcccgtgaactcgggtcagacacgcaggccacaccgcgggggccgaacgggatc
gccgtcaccgaggcgatcctcgactgtctccgcaacgcctgtgacgacgccgacgtatcg
ccaagctccgtcgtcgccgccggtatcggatcgatcggaccactggatctcgccgaggga
atcgtcgagggacccgcgaacctcccggattcgatcggtcggatcccactgaccggtccc
gtcggcaacctgatcgactcggaacgcgtgtatctgcacaacgacaccaacgccggggtg
atcggcgaacgcttcttctctgaccgcaaccccgacgacatggtgtatctgacgatctcc
tcggggatcggtgccggcgtcgccgtcgacggcaacgtcgtcgacggctgggacggcaac
gccggtgaggtcgggcacatgaccctcgacccggccggcgtgatgacgtgtggctgtggc
tcggacggccactgggaggcgtactgttcgggcaacaacatcccgaagtacgcgacgcag
ctccacacggaagacgggatggagactgcgctcccagtcgagagcggtgacttcgacgcg
gcggacgtgttcgaccgtgcgcgagacggcgacgacttcgcacagtacgtcatcgggcag
gtcggccacctcaacgctatcgggatcgcaaacgtcgtccaggcgtacgccccgctcgtg
gtctacgtcggcggagcggtagcgctgaacaaccccgacgccgtcctcgatccgatcaga
gacgaactctcggagatggtgttcggaaacatcccggacgtgaagctcacgacgctcggc
gaagacatcgtcgtcatgggcgcgctcgcctcggcgatcaccgacggcaccggcgagcgg
taa

DBGET integrated database retrieval system