KEGG   Halomicrobium mukohataei: Hmuk_2714Help
Entry
Hmuk_2714         CDS       T00982                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hmu  Halomicrobium mukohataei
Pathway
hmu00020  Citrate cycle (TCA cycle)
hmu00640  Propanoate metabolism
hmu00660  C5-Branched dibasic acid metabolism
hmu00720  Carbon fixation pathways in prokaryotes
hmu01100  Metabolic pathways
hmu01110  Biosynthesis of secondary metabolites
hmu01120  Microbial metabolism in diverse environments
hmu01130  Biosynthesis of antibiotics
hmu01200  Carbon metabolism
Module
hmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hmuk_2714
   00640 Propanoate metabolism
    Hmuk_2714
   00660 C5-Branched dibasic acid metabolism
    Hmuk_2714
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2714
Enzymes [BR:hmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hmuk_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 ATP-grasp GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ACV48820
JGI: Hmuk_2714
UniProt: C7NZQ2
Position
complement(2600850..2601998)
Genome map
AA seq 382 aa AA seqDB search
MKLHEYQAKQVFADAGVPTPASTLATTVDEAVDAAEEIGYPVAIKAQVQVGGRGKAGGIK
LAENADEAREYADDILGMDLKGLHVDRVLVEEAVDFVNELYVGVTMDRGEGKPVAMVSTR
GGVNIEEVAEEEPEAIAREHIDPAFGMHHYQARKVVYDAGVDREVANDVAGVLKTLYDLW
EDKDGSDAEINPLMVTADDEVIAADAVMNVDDDALFRHPDLEAMEDEADGGDELEQKADE
YGFDYVRLSGNVGIIGNGAGLVMTTLDLVDHFGGEPANFLDVGGGAKAQRIANALDMVFS
DDNVDSVVFNIFGGITRGDEVAKGINQALEQFDEIPKPVVVRLAGTNATEGMEILNEDLV
TVEQTLEDAVERAVIYAEEVEA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacgagtaccaggcgaagcaggtcttcgccgacgcgggggttccgacgccc
gcatcgacgctggcgacgaccgtcgacgaagcggtcgacgccgccgaggagatcggctat
ccggtcgcgatcaaggcacaggtgcaggtcggcggccgcgggaaggccggcgggatcaag
ctcgccgagaacgccgacgaggcccgtgagtacgccgacgatattctcgggatggacctc
aaggggctccacgtcgaccgcgtcctcgtcgaagaggccgtcgacttcgtcaacgagctg
tacgtcggcgtcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgacgcgc
ggcggcgtcaacatcgaggaagtcgccgaagaagagccagaggcgatcgcccgcgagcac
atcgatccggccttcggcatgcaccactaccaggcccggaaggtcgtctacgacgccggt
gtcgaccgcgaggtcgccaacgacgttgccggcgtcctcaagacgctgtacgacctctgg
gaggacaaagacggctccgacgccgagatcaacccgctgatggtcacggccgacgacgag
gtcatcgcggccgacgccgtgatgaacgtcgacgacgacgccctgttccgtcaccccgat
ctggaggcgatggaagacgaggccgacggcggcgacgaactcgaacagaaggccgacgag
tacggcttcgactacgtccgcctgtcgggcaacgtcggcatcatcggcaacggtgccggg
ctggtcatgacgacgctcgacctcgtcgaccacttcggcggcgagccggcgaacttcctc
gacgtgggcggcggtgcgaaggcccagcggatcgccaacgcgctcgatatggtgttctcc
gacgacaacgtcgactccgtcgtgttcaacatcttcggcgggatcacgcggggcgacgag
gtcgccaagggaatcaaccaggcgctcgaacagttcgacgagattcccaagcccgtcgtc
gtccgactcgcgggcaccaacgctactgaagggatggagattctcaacgaagacctcgtg
acggtcgaacagacgctcgaagacgccgtcgaacgtgccgtcatctacgccgaggaggtg
gaagcatga

DBGET integrated database retrieval system