KEGG   Halomicrobium mukohataei: Hmuk_2714Help
Entry
Hmuk_2714         CDS       T00982                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hmu  Halomicrobium mukohataei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hmuk_2714
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hmuk_2714
   00640 Propanoate metabolism
    Hmuk_2714
   00660 C5-Branched dibasic acid metabolism
    Hmuk_2714
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hmuk_2714
Enzymes [BR:hmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hmuk_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2600850..2601998)
Genome map
AA seq 382 aa AA seqDB search
MKLHEYQAKQVFADAGVPTPASTLATTVDEAVDAAEEIGYPVAIKAQVQVGGRGKAGGIK
LAENADEAREYADDILGMDLKGLHVDRVLVEEAVDFVNELYVGVTMDRGEGKPVAMVSTR
GGVNIEEVAEEEPEAIAREHIDPAFGMHHYQARKVVYDAGVDREVANDVAGVLKTLYDLW
EDKDGSDAEINPLMVTADDEVIAADAVMNVDDDALFRHPDLEAMEDEADGGDELEQKADE
YGFDYVRLSGNVGIIGNGAGLVMTTLDLVDHFGGEPANFLDVGGGAKAQRIANALDMVFS
DDNVDSVVFNIFGGITRGDEVAKGINQALEQFDEIPKPVVVRLAGTNATEGMEILNEDLV
TVEQTLEDAVERAVIYAEEVEA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacgagtaccaggcgaagcaggtcttcgccgacgcgggggttccgacgccc
gcatcgacgctggcgacgaccgtcgacgaagcggtcgacgccgccgaggagatcggctat
ccggtcgcgatcaaggcacaggtgcaggtcggcggccgcgggaaggccggcgggatcaag
ctcgccgagaacgccgacgaggcccgtgagtacgccgacgatattctcgggatggacctc
aaggggctccacgtcgaccgcgtcctcgtcgaagaggccgtcgacttcgtcaacgagctg
tacgtcggcgtcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgacgcgc
ggcggcgtcaacatcgaggaagtcgccgaagaagagccagaggcgatcgcccgcgagcac
atcgatccggccttcggcatgcaccactaccaggcccggaaggtcgtctacgacgccggt
gtcgaccgcgaggtcgccaacgacgttgccggcgtcctcaagacgctgtacgacctctgg
gaggacaaagacggctccgacgccgagatcaacccgctgatggtcacggccgacgacgag
gtcatcgcggccgacgccgtgatgaacgtcgacgacgacgccctgttccgtcaccccgat
ctggaggcgatggaagacgaggccgacggcggcgacgaactcgaacagaaggccgacgag
tacggcttcgactacgtccgcctgtcgggcaacgtcggcatcatcggcaacggtgccggg
ctggtcatgacgacgctcgacctcgtcgaccacttcggcggcgagccggcgaacttcctc
gacgtgggcggcggtgcgaaggcccagcggatcgccaacgcgctcgatatggtgttctcc
gacgacaacgtcgactccgtcgtgttcaacatcttcggcgggatcacgcggggcgacgag
gtcgccaagggaatcaaccaggcgctcgaacagttcgacgagattcccaagcccgtcgtc
gtccgactcgcgggcaccaacgctactgaagggatggagattctcaacgaagacctcgtg
acggtcgaacagacgctcgaagacgccgtcgaacgtgccgtcatctacgccgaggaggtg
gaagcatga

DBGET integrated database retrieval system